KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2449Help
Entry
NCgl2449          CDS       T00102                                 

Gene name
Cgl2537
Definition
Zn-NADPH:quinone dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NCgl2449 (Cgl2537)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCgl2449 (Cgl2537)
  Lipid metabolism
   00071 Fatty acid degradation
    NCgl2449 (Cgl2537)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NCgl2449 (Cgl2537)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NCgl2449 (Cgl2537)
   00626 Naphthalene degradation
    NCgl2449 (Cgl2537)
Enzymes [BR:cgl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NCgl2449 (Cgl2537)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2683625..2684647)
Genome map
AA seq 340 aa AA seqDB search
MTPAHIFSEGPINSVVLSQDEDGNFTTSYQDTFSDPSFLGEGDVLIEVGWSSLNYKDAMA
LKGDKGVVRTVPLIPGIDVVGTVIESADPRFGRGDEVVLNGAGLGENRHGGFTQRLKVPS
EPLLHIPFNFSAQQVGALGTAGFTAALSVNALVDQGIKPEDGEILVTGSTGGVGSIALHL
LNKLGYTTVAVTGRREAHAEYLTSLGASDIIDRAELSEKGRPLQKGRWAGVVDSVGSHTL
VNAIAQTKWGGIVTACGMAQGPDLPGTVLPFILRGVHLVGINSVDAPRELRRRAWALLSE
HLDTAVLDDMTTVIDVKDVAQAGEDLMAGKLHGRTAVRVH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgactccagctcacatattttctgaaggtccaatcaatagtgttgttctcagccaggat
gaggatggaaatttcaccacctcctaccaggacacgttctctgatccatcatttttgggg
gaaggtgacgttctaattgaggttggttggtccagcttgaattacaaggacgcaatggct
ctgaagggtgataagggagtggtgcgtactgtgccactgattccaggtatcgatgtggtg
ggcactgtgatcgagagcgctgatcctcgctttggtcgtggtgatgaagtggtgctgaat
ggcgctggtttgggggagaaccggcatggaggtttcacgcagcggctgaaagtgccgtct
gaaccgttgctgcatattccatttaacttctccgcgcagcaggtgggtgcgttgggtact
gcaggtttcacggctgcgctatcggtgaatgctctggtcgatcaaggtatcaaaccggag
gatggggagattctggtaactggttcgactggtggtgtgggttcgattgcacttcacctg
ctgaataagttgggatatacgacggtcgcggtgacggggcgtcgagaagcgcatgccgaa
tacctgaccagcctgggcgcaagcgacatcattgatcgcgcggagctttctgaaaagggc
cggccgctgcagaaggggcgttgggcgggtgtagtggattcagtgggatcccacacactt
gtcaatgcgattgctcagacaaaatggggcggaattgtcacggcgtgtggcatggctcag
gggccggatctgccgggaacggtgttgccgtttattcttcgtggcgtgcatttggttggc
attaactctgtcgatgcaccccgtgagctgcgtcgacgtgcgtgggcgttgctgtccgag
catcttgataccgcggtgctagatgatatgaccactgtgattgatgtcaaggatgttgct
caagctggcgaagatttgatggctggcaagcttcacggacgtaccgcggtgcgtgttcat
tag

DBGET integrated database retrieval system