KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2449Help
Entry
NCgl2449          CDS       T00102                                 

Gene name
Cgl2537
Definition
(RefSeq) Zn-NADPH:quinone dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00010  Glycolysis / Gluconeogenesis
cgl00071  Fatty acid degradation
cgl00350  Tyrosine metabolism
cgl00625  Chloroalkane and chloroalkene degradation
cgl00626  Naphthalene degradation
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01120  Microbial metabolism in diverse environments
cgl01130  Biosynthesis of antibiotics
cgl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCgl2449 (Cgl2537)
  Lipid metabolism
   00071 Fatty acid degradation
    NCgl2449 (Cgl2537)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NCgl2449 (Cgl2537)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NCgl2449 (Cgl2537)
   00626 Naphthalene degradation
    NCgl2449 (Cgl2537)
Enzymes [BR:cgl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NCgl2449 (Cgl2537)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Epimerase ADH_N_2 KR ELFV_dehydrog
Motif
Other DBs
NCBI-GeneID: 1020484
NCBI-ProteinID: NP_601737
UniProt: Q8NMN4
Position
complement(2683625..2684647)
Genome map
AA seq 340 aa AA seqDB search
MTPAHIFSEGPINSVVLSQDEDGNFTTSYQDTFSDPSFLGEGDVLIEVGWSSLNYKDAMA
LKGDKGVVRTVPLIPGIDVVGTVIESADPRFGRGDEVVLNGAGLGENRHGGFTQRLKVPS
EPLLHIPFNFSAQQVGALGTAGFTAALSVNALVDQGIKPEDGEILVTGSTGGVGSIALHL
LNKLGYTTVAVTGRREAHAEYLTSLGASDIIDRAELSEKGRPLQKGRWAGVVDSVGSHTL
VNAIAQTKWGGIVTACGMAQGPDLPGTVLPFILRGVHLVGINSVDAPRELRRRAWALLSE
HLDTAVLDDMTTVIDVKDVAQAGEDLMAGKLHGRTAVRVH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgactccagctcacatattttctgaaggtccaatcaatagtgttgttctcagccaggat
gaggatggaaatttcaccacctcctaccaggacacgttctctgatccatcatttttgggg
gaaggtgacgttctaattgaggttggttggtccagcttgaattacaaggacgcaatggct
ctgaagggtgataagggagtggtgcgtactgtgccactgattccaggtatcgatgtggtg
ggcactgtgatcgagagcgctgatcctcgctttggtcgtggtgatgaagtggtgctgaat
ggcgctggtttgggggagaaccggcatggaggtttcacgcagcggctgaaagtgccgtct
gaaccgttgctgcatattccatttaacttctccgcgcagcaggtgggtgcgttgggtact
gcaggtttcacggctgcgctatcggtgaatgctctggtcgatcaaggtatcaaaccggag
gatggggagattctggtaactggttcgactggtggtgtgggttcgattgcacttcacctg
ctgaataagttgggatatacgacggtcgcggtgacggggcgtcgagaagcgcatgccgaa
tacctgaccagcctgggcgcaagcgacatcattgatcgcgcggagctttctgaaaagggc
cggccgctgcagaaggggcgttgggcgggtgtagtggattcagtgggatcccacacactt
gtcaatgcgattgctcagacaaaatggggcggaattgtcacggcgtgtggcatggctcag
gggccggatctgccgggaacggtgttgccgtttattcttcgtggcgtgcatttggttggc
attaactctgtcgatgcaccccgtgagctgcgtcgacgtgcgtgggcgttgctgtccgag
catcttgataccgcggtgctagatgatatgaccactgtgattgatgtcaaggatgttgct
caagctggcgaagatttgatggctggcaagcttcacggacgtaccgcggtgcgtgttcat
tag

DBGET integrated database retrieval system