KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2502Help
Entry
NCgl2502          CDS       T00102                                 

Gene name
Cgl2591
Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00480  Glutathione metabolism
cgl00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NCgl2502 (Cgl2591)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NCgl2502 (Cgl2591)
Enzymes [BR:cgl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NCgl2502 (Cgl2591)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 1020537
NCBI-ProteinID: NP_601789
UniProt: Q8NMI2
Position
complement(2753326..2753805)
Genome map
AA seq 159 aa AA seqDB search
MTSIHDISVTLNDGTETTMADWAGHLLLIVNVASKCGLTPQYEGLQKLYEEYQDRGFFVI
GVPCNQFNGQEPGTDAEVCAFAQNQYDVTFPLLSKTEVNGEGAHPLYKVLKEATDGSEIE
WNFEKFLVDAEGNTIKRFAPRTEPSAAEVVEAIEENLPI
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacttctattcatgacatcagcgtaactctcaacgacggcacagaaaccaccatggcg
gattgggcgggccaccttttgctcatcgtgaacgtggcatccaagtgcggactcacgcca
cagtatgaagggcttcaaaaactgtatgaggaataccaagatcgaggcttctttgtcatt
ggcgtgccctgcaatcaattcaacggccaggaacctggaaccgacgctgaggtgtgtgct
ttcgcgcaaaatcagtacgacgtcaccttcccgctcttgagcaaaaccgaggtgaatggg
gagggtgcccaccccctgtacaaggtgctcaaagaggcaactgatggtagcgaaatcgag
tggaattttgagaaattcctggtagatgcagaaggtaatacgattaagcgctttgctcct
cggacggaaccatctgcagctgaggtagtggaagcaatcgaggagaatctccctatctaa

DBGET integrated database retrieval system