KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2558Help
Entry
NCgl2558          CDS       T00102                                 

Gene name
Cgl2647
Definition
(RefSeq) transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00010  Glycolysis / Gluconeogenesis
cgl00052  Galactose metabolism
cgl00500  Starch and sucrose metabolism
cgl00520  Amino sugar and nucleotide sugar metabolism
cgl00521  Streptomycin biosynthesis
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01120  Microbial metabolism in diverse environments
cgl01130  Biosynthesis of antibiotics
cgl01200  Carbon metabolism
Module
cgl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCgl2558 (Cgl2647)
   00052 Galactose metabolism
    NCgl2558 (Cgl2647)
   00500 Starch and sucrose metabolism
    NCgl2558 (Cgl2647)
   00520 Amino sugar and nucleotide sugar metabolism
    NCgl2558 (Cgl2647)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NCgl2558 (Cgl2647)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NCgl2558 (Cgl2647)
Enzymes [BR:cgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NCgl2558 (Cgl2647)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-GeneID: 1020595
NCBI-ProteinID: NP_601847
UniProt: Q8NMD1
Position
2816410..2817321
Genome map
AA seq 303 aa AA seqDB search
MTDPTCTLALDIGATKIAYALVPDNTPTTTLSTGRLGTKEGDSPIEQIRLVLLAGLKAAE
EHGLSVARIGMGAPGVILGPEGTIVYNGETLTEWAGTDLRGLSREVLNVPFAAHNDVRVW
AYGEHHLGTGKDLTGRVLYVSLGTGVGGAIIEDGIMMSSPTGTAGEFAEVVCSDHAGLAV
RCENVASGTGLTRYYNEAAATQLDLPAIMERFHQGDGLAQQIITGNLRGFGQALGALVTV
LDLSAVVVGGGVAGIGAPVMDPITAGIFDRVLTPNKSVQVLSTSLGAQAAVIAAAKYARD
NAF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcccacttgcacccttgcccttgatattggtgccacaaagattgcctacgca
ctagtccccgataacaccccgacgacaacattgtccacgggacgcttgggaacaaaagaa
ggcgacagccctatcgagcagatccggctggttcttctggcaggcttaaaagctgccgag
gaacacggtctcagtgtcgcccgcatcggcatgggcgctcctggtgtaattctgggacca
gagggaaccatcgtgtacaacggtgaaaccctcacagagtgggcaggcactgacctgcga
ggattatcccgagaagtcctcaacgttccattcgcggcacacaatgatgtccgcgtatgg
gcctacggtgagcaccacttaggcaccggcaaagacctcaccggcagggtactctacgtg
tccctcggcactggagtcggcggagcaatcatcgaagacggaatcatgatgagtagcccc
actggaactgcgggagaattcgcagaagttgtgtgctctgaccatgcaggattagccgtt
cggtgcgaaaatgtagcaagtggcaccggcctaaccaggtactacaacgaggccgccgca
actcaacttgaccttcccgccatcatggagcgcttccaccaaggtgacggcctggcacag
caaatcattactggaaatctccgaggctttggccaagcgctaggcgcattagtcacagtg
ctggacctttccgcagtagtagttggaggcggagtcgcaggcatcggcgcacccgtcatg
gatcccatcaccgcagggattttcgatcgagtgttaacccccaacaaatccgtacaagtt
ttaagcacgtcccttggtgcccaagcagccgtcatcgcagcagcaaaatatgcccgcgat
aacgccttttaa

DBGET integrated database retrieval system