KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2601Help
Entry
NCgl2601          CDS       T00102                                 

Gene name
Cgl2694
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00790  Folate biosynthesis
cgl01100  Metabolic pathways
Module
cgl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCgl2601 (Cgl2694)
Enzymes [BR:cgl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NCgl2601 (Cgl2694)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 1020641
NCBI-ProteinID: NP_601890
UniProt: Q8NM85
Position
complement(2865729..2866568)
Genome map
AA seq 279 aa AA seqDB search
MTIPGRCLVMGIVNVTEDSFSDGGKYIDVDQAIAHAKELVAAGADMIDVGGESTRPGAVR
VDASVERDRVVPVIKALHDAGIHTSVDTMRASVAQAAAGAGVSMINDVSGGLADPEMFSV
MAEAQIPVCLMHWRTLQFGDAAGQADHGGDVVADVHAVLDDLVARATAAGVAENQIVLDP
GLGFAKSREDNWRLLQALPEFISGPFPILVGASRKRFLAGVRKDRGLDVTPIDADPATAA
VTAVSAHMGAWGVRVHDVPVSRDAVDVAALWRSGGTHHG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgaccatcccgggacgctgtttggtcatgggaattgtcaatgtcactgaggattccttt
tcggacggtggcaagtacattgacgttgatcaggcgatcgcgcatgccaaggaattggtg
gctgctggcgccgacatgattgatgtcggcggcgagtccacccggcctggggcagtgcgc
gtcgacgcgtccgtggaacgggaccgggttgtgccggtcattaaggcgcttcacgacgcc
ggcatccacacttccgtagacaccatgcgggcctccgtggcgcaggctgccgcgggcgct
ggcgtctccatgatcaacgacgtctctggcggtttggctgatcctgagatgttttctgtc
atggcggaagcgcaaattcccgtgtgtttgatgcactggcgcaccctccaattcggtgat
gccgcaggtcaggcagatcacggtggagacgttgtagccgatgtgcacgcagtgcttgat
gatcttgtcgcccgcgccaccgctgctggtgtggccgaaaaccagatcgtgcttgatcca
ggtttgggttttgccaaatcacgtgaagacaactggcgtttgctgcaagcactgcccgag
tttatttctggacctttccccatcctggtgggagcatcccggaagcgattcctggctggc
gtgcgcaaagaccgtggcctagatgtcacccccattgatgccgacccagcaaccgcagcg
gtgaccgcagtgtctgcacatatgggagcatggggtgtgcgcgtgcacgatgtcccagta
tcaagggacgctgttgatgttgccgcattgtggcgaagtggaggaactcaccatggctga

DBGET integrated database retrieval system