KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2754Help
Entry
NCgl2754          CDS       T00102                                 

Gene name
Cgl2852
Definition
beta-N-acetylglucosaminidase-like protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NCgl2754 (Cgl2852)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    NCgl2754 (Cgl2852)
Enzymes [BR:cgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NCgl2754 (Cgl2852)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3040746..3041933)
Genome map
AA seq 395 aa AA seqDB search
MLPSFPIVRAVWKRLKPLAAAVAVAGVLLAGCAEEPEQQKAISRLSTSPSTPPAPTAEDL
ARAQIPEQQRDQVASLMMVGVANYDQALDALNQGVGGIFIGSWTDENLLTEPGRNIEALR
EAVGRDFSVSIDFEGGRVQRATNILGDFPSPRVMAQTMTPEQVEDLAEILGTGLAAHGVT
VNFAPVVDVDAWGLPVVGDRSFSNDPAVAATYATAFAKGLSKVGITPVFKHFPGHGRASG
DSHTQDVVTPALDELKTYDLIPYGQALSETDGAVMVGHMIVPGLGTDGVPSSIDPATYQL
LRSGDYPGGVPFDGVIYTDDLSGMSAISATHSPAEAVLASLKAGADQALWIDYGSLGSAI
DRVDAAVSSGEYPQEQMLASALRVQLLYITRLEQK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttgctgccgtcttttcctatagttagagccgtgtggaagcgattgaaacccctcgcagca
gccgtcgcggtagccggtgtgctccttgcgggctgcgcagaagagccggaacagcaaaaa
gcaataagccgcttatcgacgtccccctccacccctcccgcaccgaccgcggaggatttg
gcgcgcgcgcaaatccctgaacagcaacgcgaccaagtcgcgtcgctgatgatggttgga
gttgcgaattatgatcaggcattggatgcgctcaatcagggggtgggtggcatctttatt
ggttcctggacagatgaaaatctgctcacggaacctggccgtaatattgaggcgctccgc
gaagccgtcggcagggatttctccgtcagcatcgacttcgaaggcggccgcgtccagcgt
gccaccaatattcttggtgatttcccctcaccgcgcgtgatggcgcaaaccatgacgccg
gaacaagtagaagatctcgcagaaatcctaggcactggtttagctgcacatggtgtgaca
gttaactttgcacctgttgtagatgtagatgcttggggtctccccgtcgttggcgatcgt
tccttttccaacgacccagccgtagcagctacttatgccacagcttttgcaaagggctta
agcaaagtaggaattaccccagtattcaaacatttcccaggtcacggtcgtgcaagtggc
gattcgcacacccaagatgtggtgacccccgcacttgatgagcttaaaacttacgacctc
atcccttatggtcaagcactttctgaaactgacggagccgtcatggtgggccacatgatt
gttccaggtcttggcaccgacggagttccatcctctatcgaccccgccacctatcaactg
ctccgcagtggcgattacccaggtggcgtgcctttcgatggcgtgatctacaccgacgat
ctctctggaatgagtgccatttccgccacccattcacccgcagaagcagtgcttgcctcc
ctcaaagcaggcgcagaccaagcactatggatcgactatgggtcgttgggctccgcgatt
gatcgcgttgatgctgccgttagcagcggtgaataccctcaagaacaaatgctggcatct
gcgttaagagtccaattgctctacatcacacgtctcgaacaaaagtga

DBGET integrated database retrieval system