KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2898Help
Entry
NCgl2898          CDS       T00102                                 

Gene name
Cgl3000
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cgl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3201901..3202716
Genome map
AA seq 271 aa AA seqDB search
MIMPEGHVIHRLAGELTKNFGDTILDATSPQGRFTSEAAIINGHRIAVAEAYGKHLFVEF
DADHPEHILYIHLGLIGTLQFEPAEETRGQIRLHLSDGEIAANLRGPQWCRLITDAERTQ
AIGKLGADPIRDDADPEPIRIKVQRSGRSIGSLLMDQKLFAGVGNIYRAETLFRLGISPF
TIGKDITTAQFRSIWADLVGLMKDGVVTGRIDTVRPEHTPEAMGRPPRKDDHGGEVYTYR
RTGQECFLCATPIKEQVMEGRNLFWCPGCQR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgattatgcctgaaggacacgtgattcatcgactagctggggaactcaccaagaatttt
ggcgataccattttggacgccacttcacctcaaggacgctttacttctgaagcggcgatc
atcaacggtcaccgcatcgcggttgcggaggcttacggcaagcacctgttcgtcgagttc
gatgcggatcaccctgagcacattttgtatatccatttggggctgattggcacgttgcag
tttgaacctgcggaagaaacccgcgggcagattcgcctgcacctttccgacggggagatc
gcagctaatttgcgcggaccccaatggtgcaggttgatcaccgatgcagagcgcacccag
gccattggaaaattgggcgctgatccgattcgcgatgatgccgatccggaaccaattcgg
attaaggtgcagcgctcagggcgaagcattggttcgttgttgatggatcagaagcttttc
gcaggtgtgggaaatatctaccgtgcggagacacttttccgcctggggatttcaccgttc
accattggaaaagacatcaccacggcacagttccgatccatttgggcggatcttgttggg
ttgatgaaagacggtgttgtgactggtcggattgatactgtgcgcccggaacacacaccg
gaggcgatgggtaggccaccgcggaaagatgatcacggcggtgaggtttacacctatcgg
cgaaccggtcaagagtgctttctgtgcgcaactcccatcaaggagcaggtcatggagggt
cgcaacttattttggtgtcccggctgccaacgctag

DBGET integrated database retrieval system