KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2930Help
Entry
NCgl2930          CDS       T00102                                 

Gene name
trpC, trpF
Definition
(RefSeq) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01130  Biosynthesis of antibiotics
cgl01230  Biosynthesis of amino acids
Module
cgl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCgl2930 (trpC)
Enzymes [BR:cgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NCgl2930 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     NCgl2930 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-GeneID: 1020975
NCBI-ProteinID: NP_602226
UniProt: P06560
Position
3236642..3238066
Genome map
AA seq 474 aa AA seqDB search
MTSNNLPTVLESIVEGRRGHLEEIRARIAHVDVDALPKSTRSLFDSLNQGRGGARFIMEC
KSASPSLGMIREHYQPGEIARVYSRYASGISVLCEPDRFGGDYDHLATVAATSHLPVLCK
DFIIDPVQVHAARYFGADAILLMLSVLDDEEYAALAAEAARFDLDILTEVIDEEEVARAI
KLGAKIFGVNHRNLHDLSIDLDRSRRLSKLIPADAVLVSESGVRDTETVRQLGGHSNAFL
VGSQLTSQENVDLAARELVYGPNKVCGLTSPSAAQTARAAGAVYGGLIFEEASPRNVSRE
TLQKIIAAEPNLRYVAVSRRTSGYKDLLVDGIFAVQIHAPLQDSVEAEKALIAAVREEVG
PQVQVWRAISMSSPLGAEVAAAVEGDVDKLILDAHEGGSGEVFDWATVPAAVKAKSLLAG
GISPDNAAQALAVGCAGLDINSGVEYPAGAGTWAGAKDAGALLKIFATISTFHY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgactagtaataatctgcccacagtgttggaaagcatcgtcgagggtcgtcgcggacac
ctggaggaaattcgcgctcgcatcgctcacgtggatgtggatgcgcttccaaaatccacc
cgttctctgtttgattccctcaaccagggtaggggaggggcgcgtttcatcatggagtgc
aagtccgcatcgccttctttgggaatgattcgtgagcactaccagccgggtgaaatcgct
cgcgtgtactctcgctacgccagcggcatttccgtgctgtgcgagccggatcgttttggt
ggcgattacgatcacctcgctaccgttgccgctacctctcatcttccggtgctgtgcaaa
gacttcatcattgatcctgtccaggtacacgcggcgcgttactttggtgctgatgccatc
ctgctcatgctctctgtgcttgatgatgaagagtacgcagcactcgctgccgaggctgcg
cgttttgatctggatatcctcaccgaggttattgatgaggaggaagtcgcccgcgccatc
aagctgggtgcgaagatctttggcgtcaaccaccgcaacctgcatgatctgtccattgat
ttggatcgttcacgtcgcctgtccaagctcattccagcagatgccgtgctcgtgtctgag
tctggcgtgcgcgataccgaaaccgtccgccagctaggtgggcactccaatgcattcctc
gttggctcccagctgaccagccaggaaaacgtcgatctggcagcccgcgaattagtctac
ggccccaacaaagtctgcggactcacctcaccaagtgcagcacaaaccgctcgcgcagcg
ggtgcggtctacggcgggctcatcttcgaagaggcatcgccacgcaatgtttcacgtgaa
acattgcaaaaaatcatcgccgcagagcccaacctgcgctacgtcgcggtcagccgtcgc
acctccgggtacaaggatttgcttgtcgacggcatcttcgccgtacaaatccacgcccca
ctgcaggacagcgtcgaagcagaaaaggcattgatcgccgccgttcgtgaagaggttgga
ccgcaggtccaggtctggcgcgcgatctcgatgtccagccccttgggggctgaagtggca
gctgcggtggagggtgacgtcgataagctaattcttgatgcccatgaaggtggcagcggg
gaagtattcgactgggctacggtgccggccgctgtgaaggcaaagtctttgctcgcggga
ggcatctctccggacaacgctgcgcaggcactcgctgtgggctgcgcaggtttggacatc
aactctggcgtggaataccccgccggtgcaggcacgtgggctggggcgaaagacgccggc
gcgctgctgaaaattttcgcgaccatctccacattccattactaa

DBGET integrated database retrieval system