KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2930Help
Entry
NCgl2930          CDS       T00102                                 

Gene name
trpC, trpF
Definition
(RefSeq) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
  KO
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NCgl2930 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCgl2930 (trpC)
Enzymes [BR:cgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NCgl2930 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     NCgl2930 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3236642..3238066
Genome map
AA seq 474 aa AA seqDB search
MTSNNLPTVLESIVEGRRGHLEEIRARIAHVDVDALPKSTRSLFDSLNQGRGGARFIMEC
KSASPSLGMIREHYQPGEIARVYSRYASGISVLCEPDRFGGDYDHLATVAATSHLPVLCK
DFIIDPVQVHAARYFGADAILLMLSVLDDEEYAALAAEAARFDLDILTEVIDEEEVARAI
KLGAKIFGVNHRNLHDLSIDLDRSRRLSKLIPADAVLVSESGVRDTETVRQLGGHSNAFL
VGSQLTSQENVDLAARELVYGPNKVCGLTSPSAAQTARAAGAVYGGLIFEEASPRNVSRE
TLQKIIAAEPNLRYVAVSRRTSGYKDLLVDGIFAVQIHAPLQDSVEAEKALIAAVREEVG
PQVQVWRAISMSSPLGAEVAAAVEGDVDKLILDAHEGGSGEVFDWATVPAAVKAKSLLAG
GISPDNAAQALAVGCAGLDINSGVEYPAGAGTWAGAKDAGALLKIFATISTFHY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgactagtaataatctgcccacagtgttggaaagcatcgtcgagggtcgtcgcggacac
ctggaggaaattcgcgctcgcatcgctcacgtggatgtggatgcgcttccaaaatccacc
cgttctctgtttgattccctcaaccagggtaggggaggggcgcgtttcatcatggagtgc
aagtccgcatcgccttctttgggaatgattcgtgagcactaccagccgggtgaaatcgct
cgcgtgtactctcgctacgccagcggcatttccgtgctgtgcgagccggatcgttttggt
ggcgattacgatcacctcgctaccgttgccgctacctctcatcttccggtgctgtgcaaa
gacttcatcattgatcctgtccaggtacacgcggcgcgttactttggtgctgatgccatc
ctgctcatgctctctgtgcttgatgatgaagagtacgcagcactcgctgccgaggctgcg
cgttttgatctggatatcctcaccgaggttattgatgaggaggaagtcgcccgcgccatc
aagctgggtgcgaagatctttggcgtcaaccaccgcaacctgcatgatctgtccattgat
ttggatcgttcacgtcgcctgtccaagctcattccagcagatgccgtgctcgtgtctgag
tctggcgtgcgcgataccgaaaccgtccgccagctaggtgggcactccaatgcattcctc
gttggctcccagctgaccagccaggaaaacgtcgatctggcagcccgcgaattagtctac
ggccccaacaaagtctgcggactcacctcaccaagtgcagcacaaaccgctcgcgcagcg
ggtgcggtctacggcgggctcatcttcgaagaggcatcgccacgcaatgtttcacgtgaa
acattgcaaaaaatcatcgccgcagagcccaacctgcgctacgtcgcggtcagccgtcgc
acctccgggtacaaggatttgcttgtcgacggcatcttcgccgtacaaatccacgcccca
ctgcaggacagcgtcgaagcagaaaaggcattgatcgccgccgttcgtgaagaggttgga
ccgcaggtccaggtctggcgcgcgatctcgatgtccagccccttgggggctgaagtggca
gctgcggtggagggtgacgtcgataagctaattcttgatgcccatgaaggtggcagcggg
gaagtattcgactgggctacggtgccggccgctgtgaaggcaaagtctttgctcgcggga
ggcatctctccggacaacgctgcgcaggcactcgctgtgggctgcgcaggtttggacatc
aactctggcgtggaataccccgccggtgcaggcacgtgggctggggcgaaagacgccggc
gcgctgctgaaaattttcgcgaccatctccacattccattactaa

DBGET integrated database retrieval system