KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2931Help
Entry
NCgl2931          CDS       T00102                                 

Gene name
Cgl3034
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cgl01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cgl00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cgl00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3238083..3239336
Genome map
AA seq 417 aa AA seqDB search
MTEKENLGGSTLLPAYFGEFGGQFVAESLLPALDQLEKAFVDATNSPEFREELGGYLRDY
LGRPTPLTECSNLPLAGEGKGFARIFLKREDLVHGGAHKTNQVIGQVLLAKRMGKTRIIA
ETGAGQHGTATALACALMGLECVVYMGAKDVARQQPNVYRMQLHGAKVIPVESGSGTLKD
AVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHKVISEEAKAQMLERTGKLPDVVV
ACVGGGSNAIGMFADFIDDEGVELVGAEPAGEGLDSGKHGATITNGQIGILHGTRSYLMR
NSDGQVEESYSISAGLDYPGVGPQHAHLHATGRATYVGITDAEALQAFQYLARYEGIIPA
LESSHAFAYALKRAKTAEEEGQNLTILVSLSGRGDKDVDHVRRTLEENPELILKDNR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaagaaaacttgggcggctccacgctgctgcctgcatacttcggtgaattc
ggcggccagttcgtcgcggaatccctcctgcctgctctcgaccagctggagaaggccttc
gttgacgcgaccaacagcccagagttccgcgaagaactcggcggctacctccgcgattac
ctcggccgcccaaccccgctgaccgaatgctccaacctgccactcgcaggcgaaggcaaa
ggctttgcgcggatcttcctcaagcgcgaagacctcgtccacggcggtgcacacaaaact
aaccaggtgatcggccaggtgctgcttgccaagcgcatgggcaaaacccgcatcatcgca
gagaccggcgcaggccagcacggcaccgccaccgctctcgcatgtgcgctcatgggcctc
gagtgcgttgtctacatgggcgccaaggacgttgcccgccagcagcccaacgtctaccgc
atgcagctgcacggcgcgaaggtcatccccgtggaatctggttccggcaccctgaaggac
gccgtgaatgaagcgctgcgcgattggaccgcaaccttccacgagtcccactaccttctc
ggcaccgccgccggcccgcacccattcccaaccatcgtgcgtgaattccacaaggtgatc
tctgaggaagccaaggcacagatgctagagcgcaccggcaagcttcccgacgttgtggtc
gcctgtgtcggtggtggctccaacgccatcggcatgttcgcagacttcattgacgatgaa
ggtgtagagctcgtcggcgctgagccagccggtgaaggcctcgactccggcaagcacggc
gcaaccatcaccaacggtcagatcggcatcctgcacggcacccgttcctacctgatgcgc
aactccgacggccaagtggaagagtcctactccatctccgccggacttgattacccaggc
gtcggcccacagcacgcacacctgcacgccaccggccgcgccacctacgttggtatcacc
gacgccgaagccctccaagcattccagtacctcgcccgctacgaaggcatcatccccgca
ctggaatcctcacacgcgttcgcctacgcactcaagcgcgccaagaccgccgaagaggaa
ggccagaacttaaccatcctcgtctccctatccggccgtggcgacaaggacgttgaccac
gtgcgccgcaccctcgaagaaaatccagaactgatcctgaaggacaaccgatga

DBGET integrated database retrieval system