KEGG   Corynebacterium glutamicum MB001: cgp_0517Help
Entry
cgp_0517          CDS       T02791                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cgp_0517
Enzymes [BR:cgm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     cgp_0517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
461072..462418
Genome map
AA seq 448 aa AA seqDB search
MRFAIIGAGLAGLTAAYEIHKADPTAQIDVLEAGERIGGKLFTVPFASGPTDIGAEAFLA
ARSDAVEFFTELGLADSLVSPSAAKSQYFAGGALHAFPAGGVMGIPSNPPAGAQDTAFDW
TPGQDISVGALVRRQYGDEIVDTVVSSLLGGVYSSTADDLGVRASVPALAAALDQLAEAG
EPVTLSAAVKAVEAQREAAKTTSETRPVFQTFKGGYAELYEALAEQCGADIHLDSFVSAI
TKDGEGFAIKGGGEGTYDKVILAVPAPTAAVLLRDLAPAAAPHLRAIKLASSAVVGMRFD
SSEGLPDNSGVLVAVNEPGITAKAFTFSSKKWPHLEARGGALVRASFGRLGDEASARMDE
DLLVDAALDDLLTITGFDGRAAGLGEIFVQRWFGGLPAYGVDHIATVSAARAEIAAVPGV
EAIGAWAGGVGVPAVIADAQAAVHRLLG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgccatcatcggtgcaggccttgcgggtctgactgctgcatatgagatccat
aaagctgatcccactgcccaaatcgatgtgttggaagcaggcgaacgcattggcggcaag
ctttttacggtgccgtttgcttccggacctaccgatattggagcggaggcgtttttagct
gcgcgttccgatgcggtggagttttttactgagcttgggttggctgattctttggtcagc
ccgtctgctgcgaagtctcagtatttcgcgggcggtgcgctgcatgcgttccccgcaggt
ggagtgatgggtattccaagcaatccaccagcaggcgcgcaagacaccgcttttgattgg
actcctggccaagacatttctgttggcgccttagtgcgccgtcagtatggcgatgagatc
gtcgatactgtggtgtcttcgctgcttggtggcgtttattcctccaccgctgatgatctg
ggtgtgcgcgcttccgtgccggcacttgctgcagcccttgatcagctggctgaggccggc
gagccggtgactctgtcagctgcggtcaaggccgtggaagctcagcgggaagccgcaaaa
acaacttcagaaacccgccccgttttccagaccttcaagggcggatacgcggagctgtac
gaagcgttggcagagcaatgcggtgcagatattcacttggatagtttcgtttccgccatc
accaaagatggtgaaggttttgccatcaagggcggtggcgaaggcacctacgacaaggtg
attttggcggttcccgctccaaccgccgctgtgctgctccgcgacttggcaccggccgca
gcgccacatttgcgcgcaattaagttggcttcttcagcagtcgtcggcatgcgtttcgat
tccagcgagggcctgcccgacaactccggcgtcctggtcgctgttaatgagccgggcatc
acggcgaaggccttcacgttctcctcaaagaagtggcctcacctggaggctcgcgggggc
gcgctcgtgcgcgcgtcgttcggcaggctaggcgatgaggcgtcggcacgcatggacgag
gatttgcttgtcgacgccgccctcgacgatctcctcaccataaccgggttcgacggccgg
gctgccggactgggtgaaattttcgtgcagcgctggttcggtgggctcccagcctatgga
gttgatcacattgctaccgtttcggctgcgcgtgcagagatcgcagccgtgcctggcgtg
gaagcaattggcgcgtgggctgggggagtgggagttcccgcagttatcgcagatgcccag
gcagcagtacacaggttgctgggataa

DBGET integrated database retrieval system