KEGG   Corynebacterium glutamicum MB001: cgp_0517Help
Entry
cgp_0517          CDS       T02791                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cgm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
461072..462418
Genome map
AA seq 448 aa AA seqDB search
MRFAIIGAGLAGLTAAYEIHKADPTAQIDVLEAGERIGGKLFTVPFASGPTDIGAEAFLA
ARSDAVEFFTELGLADSLVSPSAAKSQYFAGGALHAFPAGGVMGIPSNPPAGAQDTAFDW
TPGQDISVGALVRRQYGDEIVDTVVSSLLGGVYSSTADDLGVRASVPALAAALDQLAEAG
EPVTLSAAVKAVEAQREAAKTTSETRPVFQTFKGGYAELYEALAEQCGADIHLDSFVSAI
TKDGEGFAIKGGGEGTYDKVILAVPAPTAAVLLRDLAPAAAPHLRAIKLASSAVVGMRFD
SSEGLPDNSGVLVAVNEPGITAKAFTFSSKKWPHLEARGGALVRASFGRLGDEASARMDE
DLLVDAALDDLLTITGFDGRAAGLGEIFVQRWFGGLPAYGVDHIATVSAARAEIAAVPGV
EAIGAWAGGVGVPAVIADAQAAVHRLLG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgccatcatcggtgcaggccttgcgggtctgactgctgcatatgagatccat
aaagctgatcccactgcccaaatcgatgtgttggaagcaggcgaacgcattggcggcaag
ctttttacggtgccgtttgcttccggacctaccgatattggagcggaggcgtttttagct
gcgcgttccgatgcggtggagttttttactgagcttgggttggctgattctttggtcagc
ccgtctgctgcgaagtctcagtatttcgcgggcggtgcgctgcatgcgttccccgcaggt
ggagtgatgggtattccaagcaatccaccagcaggcgcgcaagacaccgcttttgattgg
actcctggccaagacatttctgttggcgccttagtgcgccgtcagtatggcgatgagatc
gtcgatactgtggtgtcttcgctgcttggtggcgtttattcctccaccgctgatgatctg
ggtgtgcgcgcttccgtgccggcacttgctgcagcccttgatcagctggctgaggccggc
gagccggtgactctgtcagctgcggtcaaggccgtggaagctcagcgggaagccgcaaaa
acaacttcagaaacccgccccgttttccagaccttcaagggcggatacgcggagctgtac
gaagcgttggcagagcaatgcggtgcagatattcacttggatagtttcgtttccgccatc
accaaagatggtgaaggttttgccatcaagggcggtggcgaaggcacctacgacaaggtg
attttggcggttcccgctccaaccgccgctgtgctgctccgcgacttggcaccggccgca
gcgccacatttgcgcgcaattaagttggcttcttcagcagtcgtcggcatgcgtttcgat
tccagcgagggcctgcccgacaactccggcgtcctggtcgctgttaatgagccgggcatc
acggcgaaggccttcacgttctcctcaaagaagtggcctcacctggaggctcgcgggggc
gcgctcgtgcgcgcgtcgttcggcaggctaggcgatgaggcgtcggcacgcatggacgag
gatttgcttgtcgacgccgccctcgacgatctcctcaccataaccgggttcgacggccgg
gctgccggactgggtgaaattttcgtgcagcgctggttcggtgggctcccagcctatgga
gttgatcacattgctaccgtttcggctgcgcgtgcagagatcgcagccgtgcctggcgtg
gaagcaattggcgcgtgggctgggggagtgggagttcccgcagttatcgcagatgcccag
gcagcagtacacaggttgctgggataa

DBGET integrated database retrieval system