KEGG   Corynebacterium glutamicum MB001: cgp_1546Help
Entry
cgp_1546          CDS       T02791                                 

Gene name
rbsK1
Definition
putative ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cgm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    cgp_1546 (rbsK1)
Enzymes [BR:cgm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     cgp_1546 (rbsK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1420587..1421510)
Genome map
AA seq 307 aa AA seqDB search
MSNSTGTDIVVVGSINADLTAKVQRHPEPGETLLGSGGTVSAGGKGANQAVAAAQLGAKV
TMIGAVGTDQMAGEALTHLRQSGADMSAIATVDGPTGLAIITVSDDGENTIIVIPGANAS
VTAEFVDKHSQLIENAGIVLLQGEIPADGFERAVDLSQGRVVINLAPVVPVGHDQLRRAD
PLLVNEHEGALVLDMLGTPATTSDPQSLVTELLEQGFTSVVMTLGAEGALVGTPGQLTAI
PTPKIQAVDTTGSGDAFAGALVAKLSEGAGLIEAATFAARVGAYAATRPGAQASYPTLTT
DLPSTTH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactcaaccggtaccgacattgtcgttgtcggatccatcaatgccgatctcacc
gcaaaagttcaacgccaccctgaacctggagaaaccctcctgggtagcggcggcacagtg
agtgctggtggcaaaggcgccaaccaagctgtggcggcagcgcaattaggtgccaaagtc
accatgatcggtgcggtcggaaccgatcaaatggctggcgaggcgctgacacatttgcgt
caatcaggagcagatatgtccgcgattgccactgtggacggtcccactggtcttgccatc
atcactgtgtctgacgatggggaaaacaccatcatcgttatccctggcgctaacgcttct
gtcaccgcggaatttgttgataaacactcccaactcattgagaacgccggcattgtgttg
cttcagggtgagatccctgccgatggtttcgagcgtgccgttgatctttcacaaggacgt
gtggtgatcaatctggctccagttgtgcccgtgggacatgatcagctgcgtcgtgccgat
ccattgctggtcaacgaacacgaaggcgctctggtgctggacatgcttggaactccagcg
accacgtctgatccccaaagtttggtcactgaattgctggagcagggttttacttccgtg
gtgatgacacttggtgccgaaggtgctctggttggcacgccgggccaactcacggcaatt
cctaccccaaagatccaggcagtcgacacaaccggaagtggagacgcgtttgcgggggca
ctcgtcgcaaagctctctgaaggcgctggccttattgaggcggcaacttttgctgcgcgc
gttggcgcttatgccgccacgaggccgggcgctcaagcctcctaccccaccctgaccact
gacctcccctcaaccactcactga

DBGET integrated database retrieval system