KEGG   Corynebacterium glutamicum MB001: cgp_2272Help
Entry
cgp_2272          CDS       T02791                                 

Gene name
mutM1
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cgm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1954884..1955717)
Genome map
AA seq 277 aa AA seqDB search
MRRGLEDHMVGHTIVSATVLHPRAARNQLGGGPEIEANIAGLRVSAAKRRGKFLWLELID
APSGETRPDLGLLVHLGMSGQMLIKEPDAPISPHLRAKVELDNGDEVWFVDQRTFGYWWL
GDLVDGVPERVSHIATDVLDESADFSAIARNLKSRKSEIKRLLLNQEIVSGIGNIYADEM
LWQAKIHPLQRADRLSLARLEELLQAGKDVMTKALAQGGTSFDALYVNVNGNSGYFALSL
NAYAQTGEPCGRCGTLIIRESFMNRGSHYCPNCQKRR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcggtttagaagatcatatggtcggccacaccatcgtgtccgccacagtgctt
cacccgcgcgcagcccgcaatcaactcggcggtggccccgaaatcgaggccaacatcgca
gggcttagggtcagcgctgccaagcgacgcggcaaattcctctggcttgagcttatcgac
gcaccctccggcgaaacccgtcccgatttagggctactggttcaccttgggatgagtgga
caaatgctcatcaaagaaccagatgcaccaattagtccacaccttcgagccaaagtcgag
ctagataatggcgatgaagtgtggtttgtcgatcaacgcaccttcggttattggtggctc
ggcgacctagttgatggagtacccgaacgcgtctctcacattgccacagatgtattggat
gagtctgctgatttctctgcgattgcgcggaatttgaaatctcggaaatcggagatcaaa
cgcctcctgcttaaccaagagatcgtctccggcatcggaaatatctatgccgatgaaatg
ctctggcaagcaaaaattcacccattgcaacgtgccgatcgactgtccctagctcgcttg
gaagaacttcttcaagctggcaaagacgtgatgaccaaagcacttgctcaaggtggcacc
tctttcgacgcgctctatgtcaacgtcaatggcaactccggctactttgcgctgtcattg
aatgcttatgcgcaaaccggggagccgtgcggacgctgcggaacattaatcatccgggag
agtttcatgaaccgcggctcccactactgcccaaactgccagaagcggcgctag

DBGET integrated database retrieval system