KEGG   Corynebacterium glutamicum MB001: cgp_2529Help
Entry
cgp_2529          CDS       T02791                                 

Gene name
treS
Definition
trehalose synthase, maltose alpha-D-glucosyltransferase (EC:3.2.1.20)
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cgm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2206309..2208123
Genome map
AA seq 604 aa AA seqDB search
MTDTSPLNSQPSADHHPDHAARPVLDAHGLIVEHESEEFPVPAPAPGEQPWEKKNREWYK
DAVFYEVLVRAFYDPEGNGVGSLKGLTEKLDYIQWLGVDCIWIPPFYDSPLRDGGYDIRN
FREILPEFGTVDDFVELVDHAHRRGLRVITDLVMNHTSDQHAWFQESRRDPTGPYGDFYV
WSDDPTLYNEARIIFVDTEESNWTYDPVRGQYFWHRFFSHQPDLNYDNPAVQEAMLDVLR
FWLDLGLDGFRLDAVPYLFEREGTNGENLKETHDFLKLCRSVIEKEYPGRILLAEANQWP
QDVVEYFGEKDKGDECHMAFHFPLMPRIFMGVRQGSRTPISEILANTPEIPKTAQWGIFL
RNHDELTLEMVSDEERSYMYSQFASEPRMRANVGIRRRLSPLLEGDRNQLELLHGLLLSL
PGSPVLYYGDEIGMGDNIWLHDRDGVRTPMQWSNDRNGGFSKADPERLYLPAIQNDQYGY
AQVNVESQLNRENSLLRWLRNQILIRKQYRAFGAGTYREVSSTNESVLTFLREHKGQTIL
CVNNMSKYPQAVSLDLREFAGHTPREMSGGQLFPTIAEREWIVTLAPHGFFWFDLTADEK
DDME
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacctctccgttgaattctcagccgagtgcagatcaccaccctgatcacgcg
gctcgcccagttcttgatgcccacggcttgatcgttgagcacgaatcggaagagtttcca
gtccccgcacccgctcccggtgaacagccctgggagaagaaaaaccgcgagtggtacaaa
gacgccgttttctacgaagtgctggttcgtgccttctacgatccagaaggcaacggagtc
ggatcgttgaaaggcctgaccgaaaaactggattacatccagtggctcggcgtggattgc
atttggatcccaccgttttatgattccccactgcgcgacggcggttacgatatccgcaac
ttccgtgaaatcctgcccgaattcggcaccgtcgatgacttcgtggaactcgttgaccac
gcccaccgccgtggcctgcgtgttatcaccgacttggtcatgaatcacacctccgaccag
cacgcatggttccaagaatcccggcgcgacccaaccggcccctacggagatttctatgtg
tggagcgatgatcccaccctgtacaacgaagcccgcatcatctttgtagatacagaagaa
tccaactggacctatgatccggtgcgtggccagtacttctggcaccgcttcttctcccac
caaccagacctcaactacgacaaccccgcagtccaagaggccatgctagatgtcttgcgt
ttctggctggacctgggacttgatggtttccgactagatgccgttccttatctttttgaa
cgcgaaggcaccaacggcgaaaacctcaaagaaacccacgatttcctcaaactgtgtcgc
tctgtcattgagaaggaataccccggccgaatcctgctcgcagaagccaaccaatggccc
caagatgtggtcgaatacttcggtgaaaaagacaaaggcgatgaatgccacatggccttc
cacttccctttgatgccgcgcatcttcatgggagttcgccaaggttcacgcaccccgatc
agtgagatcctggccaacaccccggagattcccaagactgcccaatggggtattttcctg
cgtaatcatgatgagctcacccttgaaatggtctccgatgaggaacgcagctacatgtac
tcccaattcgcctccgaacctcgcatgcgcgccaacgtaggaatccgcaggcgcctttcc
ccactgcttgaaggcgaccgcaaccagctggaactccttcacggtttgttgctgtctcta
cctggctcacccgtgttgtattacggtgatgaaattggcatgggcgacaatatctggctc
cacgaccgcgacggagtgcgcacccccatgcagtggtccaacgaccgcaacggtggtttc
tccaaagctgatcctgaacgcctgtaccttccagcgatccaaaatgatcaatacggctac
gcccaagtaaacgtggaaagccaactcaaccgcgaaaactccctgctgcgctggctccga
aaccaaatccttatccgcaagcagtaccgcgcatttggtgccggaacctaccgtgaagtg
tcctccaccaatgagtcagtgttgacatttttacgagaacacaagggccaaaccattttg
tgtgtcaacaacatgagcaaatatcctcaggcagtctcgcttgatttgcgtgaatttgca
ggacacacccctcgagagatgtcgggcgggcagctgttccctaccattgctgaacgggag
tggattgtcactttagcccctcacggattcttctggtttgatctcaccgccgatgaaaag
gacgatatggaatga

DBGET integrated database retrieval system