KEGG   Corynebacterium glutamicum MB001: cgp_3149Help
Entry
cgp_3149          CDS       T02791                                 

Gene name
alaT
Definition
putative aspartate aminotransferase, AT class I (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cgm00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    cgp_3149 (alaT)
   01230 Biosynthesis of amino acids
    cgp_3149 (alaT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    cgp_3149 (alaT)
   00290 Valine, leucine and isoleucine biosynthesis
    cgp_3149 (alaT)
Enzymes [BR:cgm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     cgp_3149 (alaT)
    2.6.1.66  valine---pyruvate transaminase
     cgp_3149 (alaT)
Amino acid related enzymes [BR:cgm01007]
 Aminotransferase (transaminase)
  Class I
   cgp_3149 (alaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2800522..2801835
Genome map
AA seq 437 aa AA seqDB search
MTTDKRKTSKTTDTANKAVGADQAARPTRRTTRRIFDQSEKMKDVLYEIRGPVAAEAERM
ELDGHNILKLNTGNPAVFGFDAPDVIMRDMIANLPTSQGYSTSKGIIPARRAVVTRYEVV
PGFPHFDVDDVFLGNGVSELITMTTQALLNDGDEVLIPAPDYPLWTAATSLAGGKPVHYL
CDEEDDWNPSIEDIKSKISEKTKAIVVINPNNPTGAVYPRRVLEQIVEIAREHDLLILAD
EIYDRILYDDAEHISLATLAPDLLCITYNGLSKAYRVAGYRAGWMVLTGPKQYARGFIEG
LELLAGTRLCPNVPAQHAIQVALGGRQSIYDLTGEHGRLLEQRNMAWTKLNEIPGVSCVK
PMGALYAFPKLDPNVYEIHDDTQLMLDLLRAEKILMVQGTGFNWPHHDHFRVVTLPWASQ
LENAIERLGNFLSTYKQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgactacagacaagcgcaaaacctctaagaccaccgacaccgccaacaaggctgtgggc
gcggatcaggcagcgcgtcccactcggcgaacaactcgccgcatcttcgatcagtcggag
aagatgaaggacgtgctgtacgagatccgtggcccggtggccgcggaggcggaacgcatg
gagcttgatgggcataacatcttaaagctcaacacgggaaatccagccgtgttcggattc
gatgcccccgacgtgattatgcgtgacatgatcgccaaccttccaacttcccaagggtat
tccacctccaaaggcattattccggcccggcgagcagtggtcacccgctacgaagttgtg
cccggattcccccacttcgatgttgatgatgtgttcttaggcaacggtgtctcagaacta
atcaccatgaccacccaagcactcctcaacgacggcgatgaagttcttatccccgcaccg
gactacccactgtggactgccgcaacctccctggctggtggtaagcctgtgcactacctc
tgtgatgaggaagatgactggaacccatccatcgaagacatcaagtccaaaatctcagag
aaaaccaaagctattgtggtgatcaaccccaacaaccccacgggagctgtctacccgcgc
cgggtgttggaacaaatcgtcgagattgcacgcgagcatgacctgctgattttggccgat
gaaatctacgaccgcattctctacgatgatgccgagcacatcagcctggcaacccttgca
ccagatctcctttgcatcacatacaacggtctatccaaggcataccgcgtcgcaggatac
cgagctggctggatggtattgactggaccaaagcaatacgcacgtggatttattgagggc
ctcgaactcctcgcaggcactcgactctgcccaaatgtcccagctcagcacgctattcag
gtagctctcggtggacgccagtccatctacgacctcactggcgaacacggccgactcctg
gaacagcgcaacatggcatggacgaaactcaacgaaatcccaggtgtcagctgtgtgaaa
ccaatgggagctctatacgcgttccccaagctcgaccccaacgtgtacgaaatccacgac
gacacccaactcatgctggatcttctccgtgccgagaaaatcctcatggttcagggcact
ggcttcaactggccacatcacgatcacttccgagtggtcaccctgccatgggcatcccag
ttggaaaacgcaattgagcgcctgggtaacttcctgtccacttacaagcagtag

DBGET integrated database retrieval system