KEGG   Corynebacterium glutamicum MB001: cgp_3149Help
Entry
cgp_3149          CDS       T02791                                 

Gene name
alaT
Definition
(GenBank) putative aspartate aminotransferase, AT class I
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
cgm00220  Arginine biosynthesis
cgm00250  Alanine, aspartate and glutamate metabolism
cgm00290  Valine, leucine and isoleucine biosynthesis
cgm01100  Metabolic pathways
cgm01110  Biosynthesis of secondary metabolites
cgm01130  Biosynthesis of antibiotics
cgm01210  2-Oxocarboxylic acid metabolism
cgm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cgm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    cgp_3149 (alaT)
   00290 Valine, leucine and isoleucine biosynthesis
    cgp_3149 (alaT)
   00220 Arginine biosynthesis
    cgp_3149 (alaT)
Enzymes [BR:cgm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     cgp_3149 (alaT)
    2.6.1.66  valine---pyruvate transaminase
     cgp_3149 (alaT)
Amino acid related enzymes [BR:cgm01007]
 Aminotransferase (transaminase)
  Class I
   cgp_3149 (alaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Strep_his_triad Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGT06552
Position
2800522..2801835
Genome map
AA seq 437 aa AA seqDB search
MTTDKRKTSKTTDTANKAVGADQAARPTRRTTRRIFDQSEKMKDVLYEIRGPVAAEAERM
ELDGHNILKLNTGNPAVFGFDAPDVIMRDMIANLPTSQGYSTSKGIIPARRAVVTRYEVV
PGFPHFDVDDVFLGNGVSELITMTTQALLNDGDEVLIPAPDYPLWTAATSLAGGKPVHYL
CDEEDDWNPSIEDIKSKISEKTKAIVVINPNNPTGAVYPRRVLEQIVEIAREHDLLILAD
EIYDRILYDDAEHISLATLAPDLLCITYNGLSKAYRVAGYRAGWMVLTGPKQYARGFIEG
LELLAGTRLCPNVPAQHAIQVALGGRQSIYDLTGEHGRLLEQRNMAWTKLNEIPGVSCVK
PMGALYAFPKLDPNVYEIHDDTQLMLDLLRAEKILMVQGTGFNWPHHDHFRVVTLPWASQ
LENAIERLGNFLSTYKQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgactacagacaagcgcaaaacctctaagaccaccgacaccgccaacaaggctgtgggc
gcggatcaggcagcgcgtcccactcggcgaacaactcgccgcatcttcgatcagtcggag
aagatgaaggacgtgctgtacgagatccgtggcccggtggccgcggaggcggaacgcatg
gagcttgatgggcataacatcttaaagctcaacacgggaaatccagccgtgttcggattc
gatgcccccgacgtgattatgcgtgacatgatcgccaaccttccaacttcccaagggtat
tccacctccaaaggcattattccggcccggcgagcagtggtcacccgctacgaagttgtg
cccggattcccccacttcgatgttgatgatgtgttcttaggcaacggtgtctcagaacta
atcaccatgaccacccaagcactcctcaacgacggcgatgaagttcttatccccgcaccg
gactacccactgtggactgccgcaacctccctggctggtggtaagcctgtgcactacctc
tgtgatgaggaagatgactggaacccatccatcgaagacatcaagtccaaaatctcagag
aaaaccaaagctattgtggtgatcaaccccaacaaccccacgggagctgtctacccgcgc
cgggtgttggaacaaatcgtcgagattgcacgcgagcatgacctgctgattttggccgat
gaaatctacgaccgcattctctacgatgatgccgagcacatcagcctggcaacccttgca
ccagatctcctttgcatcacatacaacggtctatccaaggcataccgcgtcgcaggatac
cgagctggctggatggtattgactggaccaaagcaatacgcacgtggatttattgagggc
ctcgaactcctcgcaggcactcgactctgcccaaatgtcccagctcagcacgctattcag
gtagctctcggtggacgccagtccatctacgacctcactggcgaacacggccgactcctg
gaacagcgcaacatggcatggacgaaactcaacgaaatcccaggtgtcagctgtgtgaaa
ccaatgggagctctatacgcgttccccaagctcgaccccaacgtgtacgaaatccacgac
gacacccaactcatgctggatcttctccgtgccgagaaaatcctcatggttcagggcact
ggcttcaactggccacatcacgatcacttccgagtggtcaccctgccatgggcatcccag
ttggaaaacgcaattgagcgcctgggtaacttcctgtccacttacaagcagtag

DBGET integrated database retrieval system