KEGG   Coriobacterium glomerans: Corgl_0161Help
Entry
Corgl_0161        CDS       T01453                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cgo  Coriobacterium glomerans
Pathway
cgo00250  Alanine, aspartate and glutamate metabolism
cgo01100  Metabolic pathways
cgo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Corgl_0161
Enzymes [BR:cgo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Corgl_0161
Peptidases [BR:cgo01002]
 Cysteine Peptidases
  Family C44
   Corgl_0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700
Motif
Other DBs
NCBI-ProteinID: AEB06288
JGI: Corgl_0161
UniProt: F2NAA2
Position
187157..189037
Genome map
AA seq 626 aa AA seqDB search
MCGFVGFTGTLDMEQDARAEVLEAMMNRIIHRGPDMGGQYFSDDVALGFRRLSILDLSEA
GAQPMGNEEGTVQVVFNGEIYNFRELRAELEAAGYVFHSNTDTEVLVHGYEAWSETLVDH
LRGMYSFVVYDSRRRRLFGARDIFGIKPFYWYRTPGENELLFGSEIKGFLEHPHFVKAVN
RAALRPYLTLQYPATEETFFAGVFKLPAAHCFTFELETGAMNIRRYWDCDFSEVDKPFER
YVEELDAQVRESVSAHRIADVKVGSFLSGGVDSSYITACLMPDSTFSVGFDYQGFNETDY
AAELSERLGITNHRKMVSAEEFFQALPDIQYHMDEPQSNLSSVPLYFLAQMAAEQVTVVL
SGEGADELFAGYEWYEDTPPMAGFKRAMPLSVRRALGKLAARLPHVKGRSFLLKCAEVPE
RWYVGQAFVYDTDEADAILKRDYDRGPDAFELCAPVYERAKCYRELSKKQYLDMNMWLPG
DILLKADKMCMAHSLELRVPFLDRKVMALAERVPERFRVNEHGNKQVLRHAANRILPDEW
ATRPKKGFPVPFRFWLREPRYRDMVKAYFSADWAREFFDTDKLMSLLDDHFEGKAMNQRK
IYTALVFLIWYKRFFIDESRSHPAAA
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattcgtcggattcaccggcacgctcgatatggagcaggatgcgagagccgag
gttctcgaggctatgatgaaccgcatcatccaccgcggccccgatatgggcggccaatac
ttctcagacgatgtcgcactcggcttccgccgactttcgatcttggatctctccgaggcc
ggagcccagccgatgggcaacgaggagggcacggtccaagttgtgttcaacggcgagatc
tacaacttccgggagctgcgcgccgagctcgaggccgccggatacgtctttcacagcaac
acggacaccgaagtgctcgtccacggttacgaggcgtggagcgagactctcgtcgatcac
ctgcgcggcatgtacagcttcgtcgtgtacgacagcaggcgccgtcgcctgttcggcgcg
cgcgacatcttcggcatcaagccgttctactggtaccgcacgcccggtgaaaacgagctg
ctgttcggaagcgagatcaagggttttctcgagcaccctcacttcgtgaaagcggtgaat
cgcgcggcgttgcgcccctatctcacgctgcagtatcccgcgaccgaggagacgttcttc
gctggagtgttcaagcttccggcggcgcactgtttcacgtttgagcttgaaacaggcgcg
atgaacatccgtcgttactgggactgtgatttctctgaggtcgacaagccgttcgagcgc
tacgtcgaggagctcgacgcgcaggttcgcgagagcgtgtccgcgcaccgcatcgccgat
gtcaaggtgggatcgttcctgtcagggggcgtggattccagctacatcaccgcgtgcctc
atgccggacagcaccttctcggtgggcttcgactatcaggggttcaatgaaacggattat
gcggccgagctgtcggagagactgggtatcaccaaccaccggaagatggtgagcgccgag
gagtttttccaagctcttcccgacatccaatatcatatggatgagccccagtcgaatctt
tcgagcgtgccgctgtacttcttggctcagatggccgccgagcaggtgaccgtcgtcctt
tcgggcgaaggcgcagacgagctgttcgccggatatgaatggtacgaggacactccaccg
atggcgggcttcaaacgggcgatgcctctctctgtgcgccgcgcgctcggcaagctggcc
gcgcggttgccgcatgtgaagggtcgcagcttccttctgaaatgcgctgaggttcccgag
cgctggtatgttgggcaggcgttcgtctacgacaccgatgaggcggacgcgatattgaag
cgcgactacgataggggcccggacgccttcgagctctgtgcgcccgtctatgagagggcg
aagtgctatcgggagctgtccaaaaagcaatatctcgacatgaatatgtggctgcccggg
gacattctgctcaaggccgacaagatgtgcatggcgcattcgcttgagctgcgcgttccc
ttcttggaccgcaaggtgatggcgctcgcggagcgcgtccccgaacggttccgcgtgaac
gaacacggcaacaagcaggtgctgagacatgctgcaaaccggattcttcccgatgagtgg
gccacgcgccccaagaagggctttcccgtgccctttagattctggctgcgtgagccgagg
taccgcgatatggtgaaggcctacttctcggctgactgggcacgtgagttcttcgacacc
gacaagctgatgagcctgcttgacgaccatttcgagggcaaggcgatgaaccagcgcaag
atctacaccgccctcgtgttcctcatctggtacaagcggttcttcatcgacgagtcccgg
tcgcatccggcagcagcctga

DBGET integrated database retrieval system