KEGG   Coriobacterium glomerans: Corgl_0429Help
Entry
Corgl_0429        CDS       T01453                                 

Definition
thymidylate kinase (EC:2.7.4.9)
Orthology
K00943  
dTMP kinase [EC:2.7.4.9]
Organism
cgo  Coriobacterium glomerans
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cgo00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
500130..500858
Genome map
AA seq 242 aa AA seqDB search
MSRNMHAKVAGITARHDRPKAPSPAFITLEGIDGCGKSTQARLLAATLEHAGYEVELLRE
PGGAAISEKIRQLLLDPANAEMSATCELMLYEAARAQLVHQLIVPALQTGRVVVCDRFYD
STTSYQSFGSGIDRATVDTANGLAVGAIRPLITIVCDIAPDLAAERMPGRARDRMEAKGA
AFQQRAAEGFRAIAAEEPERVRLIDASEDVAHVLLRSVAELIAVGFQITDTDAHVAFTAA
YA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcaacatgcatgccaaggtggcgggtatcacggctcgtcacgatcgcccgaag
gccccctcgccggcgttcatcacgctcgagggcatcgacgggtgcggcaagtccacgcag
gcgcggctgctggcagcgacgttggagcacgcgggctacgaggtcgagctgctccgcgag
ccgggcggcgcggccatctcggagaagattcgtcagctgctgctggatcctgccaacgcc
gagatgagcgcgacctgcgagctcatgctctacgaggcggctcgagcccaattggtccat
cagctcatcgtaccggctctgcagacgggtcgcgtcgtcgtatgcgatcgcttttacgac
tctaccacgtcctaccagtcgttcggctccggcatcgatcgcgcgaccgtcgatacggca
aacggtttggccgtcggcgcgattcgcccgctcatcacgatcgtctgcgatatcgctccg
gatctcgccgccgagcggatgcccggccgcgcacgggatcgaatggaggccaagggcgcc
gcattccagcagcgcgccgcggagggctttcgcgccatcgcggcagaggagcccgagcgc
gtgaggctgatcgatgcatccgaggacgtggcgcacgtcctgcttcgctcggtcgccgaa
ctcatcgcagtcggatttcagatcaccgataccgatgctcacgtcgcattcaccgcggcc
tacgcgtga

DBGET integrated database retrieval system