KEGG   Coriobacterium glomerans: Corgl_0536Help
Entry
Corgl_0536        CDS       T01453                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cgo  Coriobacterium glomerans
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cgo00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
627050..627712
Genome map
AA seq 220 aa AA seqDB search
MIGYDEVPDYEIKRQIVEVAKMMNRKGLVGTYEGNISVRKKGKVYETPTMQSKELLTEGK
IICVDMNGEQLEGELKPTSETPMHTKCYTLRNDIHAVVHCHAPHCTAFAQAGQDYVDMAS
PEFQILFGRVPCLGYGTPGSPDIIDELPNYIAEFDVVFLAQHGVLAVGETPLEAYSKIMS
VEMLLQTYFTRKMLFPESMCDLPACEIEALMKIRESNRKG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgattggatacgatgaagtaccggattatgagataaagcgtcagatcgtcgaagtcgcg
aagatgatgaatcgaaaaggtttggtcggtacctacgagggaaacatttccgttcgaaag
aagggaaaagtatatgagactcccacgatgcagagcaaggagctgctgacagaaggaaag
atcatttgcgttgacatgaatggagaacagttggaaggggagctcaagcctacttcggag
actccgatgcatacgaagtgctatacacttcgcaacgacatacatgcagttgttcattgt
catgccccgcactgtacagcgtttgcgcaggcgggtcaggattatgtggatatggcgtct
cctgagtttcaaattctgttcggtcgcgtgccgtgtcttgggtatgggacgcctggatct
ccggacatcattgatgagttgccgaattatatcgcggaatttgatgtcgtgtttctggcc
cagcatggtgtgcttgcagtgggggagacgcctcttgaagcgtactcgaaaatcatgtct
gtcgagatgctgctccagacatacttcacccgcaaaatgctgttcccggaatcgatgtgc
gatcttccggcatgtgaaatcgaggctcttatgaagattcgcgagtcaaatcgtaaaggg
taa

DBGET integrated database retrieval system