KEGG   Coriobacterium glomerans: Corgl_0596Help
Entry
Corgl_0596        CDS       T01453                                 

Definition
Histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cgo  Coriobacterium glomerans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
698149..699993
Genome map
AA seq 614 aa AA seqDB search
MQILNALRRGEEPSERDLGRLVNAQAKLAHQDKRRFSKRRLLPFYFQIKREQPARWKSWD
VSPELERSLIAALRMKPRRSASGVSTITVITKPWACSGSCVFCPSDIRMPKSYLHDEPAC
ARAEQNMFDPYLQVSSRLVSLAQMGHAIDKIELIVLGGTWSDYPFDYQVWFISELFRALN
ECTIGGAAQTDLLSTAGPGIDPTPVGVRQRREWYSARGFGFGAPADAERVRSAQLAIDRA
ELSYNAAVERVYGTAAAVPPIGRGELADLDGLETLQHSNESARCRAVGLVIETRPDAVTA
ESLRLLRRLGCTKVQMGIQSLDQGILDANGRGITVDRIERACSLLRLFGFKTHVHFMVNL
MGATPERDRRDYERLVGDPAFLPDEVKLYPCVLVQGARLASCYADGSWRPYTEDELIGVL
SDDVLATPAFVRVSRMIRDFSANDILAGSKRSNLRQLVEASLAGRPVREIRYREIGAADI
DIEELAVDVVDYETTVSSERFLQWVTPGGAIAGFLRLSLPHLESVGERGDELPIGPGEAM
IREVHIYGVATRIAAQGGSAQHRGLGRRLIERACDIAREQGYTKMNVISAVGTRAYYRRL
GFVDAGLYQQRTLI
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
ttgcagatactcaacgcattgagacgcggcgaggaaccatccgagcgcgatctcggaagg
ctcgtcaacgctcaggccaagctcgcgcatcaagataagaggcggttctcgaagcgtcgg
ctgctgcccttctattttcagatcaaacgcgagcagccggcgcgctggaagagctgggat
gtctcaccggagctcgagcgatccctcatcgccgcgcttcgcatgaaacccagacgctcc
gcttcgggggtttccacgataacggtgataacgaagccctgggcgtgctcgggctcgtgt
gtgttctgtccgagcgatattcgcatgcccaagagctatctccacgatgaacccgcctgc
gctcgcgccgagcagaatatgttcgatccctacctgcaggtatcctctcgtctcgtttcg
ctggcgcagatgggccacgctatcgacaagatcgagctcatcgtgctcggtgggacctgg
agcgactatccttttgactatcaggtctggttcatctccgagctctttcgagccctcaat
gagtgcaccatcggcggcgccgcacagactgatctcctctcgacggcgggcccggggatc
gatccgactccggtgggggtgcgacagcgacgcgaatggtattccgcgcggggattcggc
ttcggcgcgcccgccgacgccgagcgcgtgcgctcggctcagctcgccatcgatcgcgca
gagctgagctataacgcggcagtggagcgggtgtacggcacggctgccgctgttccgccg
atcggccgaggcgagctggccgacctcgacggtctcgagactctgcagcacagcaatgag
tccgcgcgctgccgtgccgtgggcctcgtgatcgagacgcgtcctgatgccgtcacagct
gaaagcctgcgtcttcttcggcggcttggttgcacaaaggtgcagatggggatccagagc
ctcgaccagggcattctggatgccaacggacgcgggatcacggtcgacaggatcgagcgc
gcctgctctctgctgcggctgttcggcttcaagacccacgtccacttcatggtcaatctc
atgggagcaaccccggagcgcgaccggcgcgattacgagcgtcttgtcggcgatccggca
tttctgcccgacgaggtgaaactgtacccgtgcgttctggtgcagggggctcgtctcgcc
tcatgctatgctgacggttcatggaggccctacaccgaagatgagctgatcggtgtgctt
tccgatgatgtgcttgcgaccccggccttcgttcgcgtctccaggatgatccgtgatttc
tcagccaatgatatactggctggcagcaagcgttcgaatctcagacagctcgtcgaggcc
tcgctcgccggacgtccggtacgcgagattcgctatcgcgagatcggtgccgcagacatc
gacatcgaggagctcgctgtcgatgtcgtcgattacgagacgacggtctcctccgagcgg
ttcttgcaatgggtcacgcctggcggcgcgatcgcgggctttctcagactgtccctgccg
catcttgaatctgtcggcgagcgaggcgatgagctgccgatcgggcccggcgaggcgatg
attcgcgaggtgcacatctacggcgtggcaacgcgcatcgccgctcaagggggctccgct
cagcaccgaggactcgggcgccgcctcatcgagcgggcctgcgacatcgcgcgcgagcag
ggttacacgaagatgaacgtgatcagcgcagtggggacccgcgcctactatcgacgcctc
ggctttgtcgacgccggtctctaccagcaaaggacgcttatatga

DBGET integrated database retrieval system