KEGG   Coriobacterium glomerans: Corgl_0661Help
Entry
Corgl_0661        CDS       T01453                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cgo  Coriobacterium glomerans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cgo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cgo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cgo00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:cgo00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cgo00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(789851..790627)
Genome map
AA seq 258 aa AA seqDB search
MSAESDSIMRLVLIRHGESAWNRLNLFTGWTDVDLTDTGRQEAADGGRALRREGLDFDIC
YTSYLKRAIRTLNIVLEELDREWLPVTKSWKLNERHYGALQGLNKTETAQKYGEDQVKIW
RRSFDVRPPALDAGDERDPHGMAMYREVNADELPLSEALSDTIARAWPYFQKRILPEMRS
GRRVLIAAHGNSLRALVKQFDHLGDDEIAGVNIPTGIPLVYEFDAQMNVTDKRYLGDPAA
IEAKMNAVADQGKASRPA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagaatctgatagcatcatgaggctcgtgctcatccgccacggcgagagcgcg
tggaacagactcaatctgttcacgggatggaccgacgtcgatctgaccgacaccggccgt
caggaggcggcggacggtggcagggcgctgcggcgggaggggctcgacttcgacatctgc
tacacatcgtatctgaagcgcgccatccgcaccttgaacatcgtgttggaggagcttgat
cgcgagtggctgcccgtcaccaagagctggaagctcaacgagaggcactacggcgcgctt
cagggtctgaacaagaccgagaccgcccagaagtacggcgaggaccaagtgaagatctgg
aggcgcagcttcgatgtgcgaccgcccgcgctcgatgcgggcgatgaacgcgatcctcat
ggcatggcgatgtatcgcgaggtgaacgccgatgagctgcccttgagcgaggccttgagc
gacacgatcgcgcgcgcctggccctactttcagaagcgcatcctaccagagatgagatcc
ggccgtcgggtgctcatcgcagcgcacggcaactccctgcgcgctctcgtcaagcagttc
gatcatctcggcgacgatgagatcgctggcgtgaacatccccacgggcatccccttggtc
tacgagttcgacgcgcagatgaacgtgacagacaaacgctacctcggagatccggctgcg
atcgaagccaagatgaacgccgtcgccgatcagggcaaggcgagcaggcccgcctga

DBGET integrated database retrieval system