KEGG   Coriobacterium glomerans: Corgl_0669Help
Entry
Corgl_0669        CDS       T01453                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cgo  Coriobacterium glomerans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Corgl_0669
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Corgl_0669
Enzymes [BR:cgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Corgl_0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
798574..799695
Genome map
AA seq 373 aa AA seqDB search
MSSYRTMVVKIGSSLLVNPDGGIANAFIRDLALQASHLRGSGWRLVVVSSGAIACGVPVL
HLDARPSDMPTLQACASVGQCVLSAIYDKAFSAAGLLSSLVLLTRHDTARRTSYLHARDA
LVRLVELGVVPVVNENDTVSVEEIRFGDNDTLAALVACLVSADLCVTLSDIDGLYTTNPA
IDPTARFIPVVERIDGAIIAGAGDSSSAVGTGGMITKVRASRILMTAGIPSVICSGAEPR
ALVRLARSERIGTLFEPAAPRTEIAPRKLWIALGDAAHGSVSVDPGAACAIREHGSSLLP
VGIVAVRGEFTTGEILDICDDEGLVIARGRAGAPSDELKLAAGRHQDEIASNRLLVALAN
RPAVHRDEMIVFT
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcatatagaacgatggtggtgaaaatcggctcatcgcttctggtgaatccagac
ggcgggatcgcgaacgcctttatccgcgatctcgccttgcaggcgtcgcacctgcggggc
tcgggctggcgcctcgtcgtggtcagctccggggccatcgcctgcggagttccggttctg
catctcgacgcgagaccctcagatatgccgacgctccaggcgtgcgcatcagtgggacag
tgcgtcttgtcggccatctatgacaaggcgttcagcgcggcggggctgctgagttcgctg
gtgctgctgacccggcacgatacggcgaggcgaacctcctatctgcatgctcgcgacgcg
cttgtgcgcctggtcgagctcggggtggtcccggtcgtgaacgagaacgacaccgtgagc
gtcgaggagatccgcttcggtgacaacgacacgctcgcagcccttgtagcctgcttggtc
tcggccgatctgtgcgtgaccctgtcggacatcgatgggctctacacgaccaatcccgcg
atcgatccgacggctcgcttcatcccggtggttgagcgcatcgacggcgcgatcatcgcc
ggggcgggcgactcatcgagcgcggtgggcaccggcggcatgatcacgaaggtccgcgcc
agccggattctcatgacagctggcatcccgagcgtgatctgctcgggtgccgagccccgg
gcactcgtgaggctcgcccgcagcgaacggatcgggacgctgttcgaaccggcggccccg
cgcaccgagatcgcaccgcgaaagctctggatcgcgctgggggatgccgcgcacggttcg
gtgagcgtcgatcccggcgcggcatgcgcgatcagagagcacggttcctcgctgttgccg
gtcggtatcgtcgcggtgcgcggtgagttcacgaccggtgagatcctcgacatctgcgat
gacgagggactcgtgatcgcgcggggacgcgcgggcgccccatcggacgagctcaagctg
gccgccgggcgccatcaggacgagatcgcctccaatcgcctgctcgtcgccttggcgaac
aggccggcggtgcatcgcgacgagatgatcgtgttcacataa

DBGET integrated database retrieval system