KEGG   Coriobacterium glomerans: Corgl_0818Help
Entry
Corgl_0818        CDS       T01453                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cgo  Coriobacterium glomerans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cgo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cgo00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
960984..961580
Genome map
AA seq 198 aa AA seqDB search
MRETESVTSIGTGRSLGSRASQPTSSTLPNLFAIVSVCRDWGIGCAGDMVVRNRVDMRHF
VSLTRGHAVIMGRKTLESLPGGAPLRDRRNIVLTHDETFAREGVTTVCTAAAAIGAIAEE
DEAWLIGGAAVYRLLLPFCSRAFVTKHDCVRTCDAYFPDLDVDPAWSLECAGTRAVLASG
EGDEGLGYSFDVYVRSSL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgagagaaaccgagagcgtcacatcgatcggtacgggccgatcgcttggatcgcgggcg
tcgcagccgacgtcttccaccctgcccaacctgttcgccatcgtatcggtctgtcgggat
tggggtatcggatgcgcgggcgacatggtcgtgcgcaaccgcgtcgatatgcgccacttc
gtctccttgacgcgcggccatgccgtcatcatgggtcgcaagacgctggaaagcctgccc
ggtggcgcccccctcagggatcgtcgcaacatcgtgctcacgcacgatgagaccttcgcg
cgcgaaggcgtgacgaccgtctgcacggccgcggcagcgatcggagccatcgcagaggaa
gacgaggcatggctcatcggtggcgcagcggtctatcgattgctgcttcccttctgcagt
cgggctttcgttacgaagcacgattgcgtgcggacctgcgacgcctacttcccggatctg
gatgtcgatcccgcctggagcctggagtgcgccgggacccgcgcggtgctcgcgtccggc
gagggggacgagggtctcgggtactcgttcgacgtctacgtgaggagttccctgtga

DBGET integrated database retrieval system