KEGG   Coriobacterium glomerans: Corgl_0941Help
Entry
Corgl_0941        CDS       T01453                                 

Definition
aryl-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cgo  Coriobacterium glomerans
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cgo00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1091541..1092944)
Genome map
AA seq 467 aa AA seqDB search
MIKKAHLPQQFFFGAALSGPQTEGAWKQYGKLESVWDRWSQDDIDCFHNKVGSYVGNDMI
NRCEEDYQIFRSLGLTTARTSIQWTRLVDQNGALNRAGADLYHRMIATAKREGIDLFINL
YHFDMPAYLLDRGGWENREVVEAFANYARLAFREFGHEVHCWFTFNEPIVEPENSYTKGL
NIPFIRDFRRACAVQYHIALAHSLAAREFRLAKAAGLLQNDAKLGLVNNFAPPYTKSSPT
DADLDAVRMVDGLHNRWWLDLVTRGSLPCDILDTLGKRGISLPIRPGDEELLSFGTVDWL
GFNYYEPMRVQAPDNSIDDEGNPVFAKPYVWSKRKMNESRGWEIYPKGIYDFGMKIKRDY
PGLEFFVSENGMGVENEDLFRDDEGLVQDDYRIAFIREHLFWIARAIDEGANCVGYHYWA
VIDNWSWTNAFKNRYGIIGVDLAHNYERYEKKSAAWMRKLTATHVVE
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaggcgcatcttccacagcagtttttcttcggtgcagccctctccggaccg
cagacggaaggcgcgtggaagcagtatggaaagctggagagcgtatgggatcgatggtct
caagacgatatcgattgttttcataataaagttgggtcttacgtgggcaatgatatgatt
aatcgatgtgaagaagattatcagatctttcgcagtctgggtctgacaacagcccgaact
tcaatccaatggacacgacttgttgatcaaaatggcgccttgaatcgggctggcgcggat
ttataccaccgtatgatagccacggcaaaacgggaaggcattgatctttttatcaatctt
tatcatttcgacatgcccgcgtatcttttggatcgtggtggctgggaaaatcgcgaggtc
gtcgaagcgtttgcaaactacgcccggttagcctttcgcgagtttgggcatgaagtccac
tgctggtttacgtttaacgaaccgatcgtggaaccagagaacagttacacaaagggtttg
aatatcccctttatcagagatttcagacgtgcatgtgccgttcagtatcacattgcgctc
gctcattcgctcgcggcgcgcgagtttcgtctcgcgaaggccgctgggctcttgcaaaac
gatgcgaaacttggtcttgtgaataattttgcaccaccctatacgaagagcagccctact
gacgctgatctggatgcagtacgcatggtcgatggtctgcacaaccgttggtggctcgat
ctagtgacgcgaggctcactgccttgcgatattcttgacacgcttgggaaacgaggcatc
tcgctgcctattcgtcctggtgatgaagagcttctatccttcggcactgtggactggctc
ggcttcaattactatgagccgatgcgcgttcaagcacccgacaactcgattgatgatgaa
ggaaatcctgttttcgcaaaaccgtatgtctggtcgaagcgaaagatgaacgaaagtcgt
gggtgggaaatctaccccaaaggtatttacgactttggaatgaaaatcaagcgcgattat
ccaggtcttgagttcttcgtttctgaaaacggcatgggggtcgaaaacgaagatttattt
cgtgacgatgaggggctagttcaagatgattatcggatagctttcattcgagaacatctg
ttttggatagcccgagcaattgacgagggcgcaaactgcgtcggatatcattactgggct
gttatcgacaattggtcttggacgaatgccttcaaaaaccgttatggaataattggtgtc
gatctcgctcacaactatgagagatacgaaaagaagtctgcagcttggatgagaaaactt
acagcaacacatgtcgttgaatag

DBGET integrated database retrieval system