KEGG   Coriobacterium glomerans: Corgl_1066Help
Entry
Corgl_1066        CDS       T01453                                 

Definition
alcohol dehydrogenase AdhE (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cgo  Coriobacterium glomerans
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Corgl_1066
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Corgl_1066
   00620 Pyruvate metabolism
    Corgl_1066
   00650 Butanoate metabolism
    Corgl_1066
  Lipid metabolism
   00071 Fatty acid degradation
    Corgl_1066
  Amino acid metabolism
   00350 Tyrosine metabolism
    Corgl_1066
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Corgl_1066
   00626 Naphthalene degradation
    Corgl_1066
Enzymes [BR:cgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Corgl_1066
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Corgl_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1227146..1229794
Genome map
AA seq 882 aa AA seqDB search
MVKKKPSATTAPELVDSVESLEAKLASMREAQGIFSTFSQDQVDKIFYEAAMAANKARIP
LARLAVEETGRGVLEDKVIKNHYAAEYIYNAYKRTKTCGVIERDDAYGITKVAEPVGIVG
AVIPTTNPTSTAIFKCLICLKTRNAIIISPHPAAARCTIAAARIVLEAAVAAGAPEGIIG
WVDVPSLELTNKVMADVDTILATGGPGMVKAAYSSGKPALGVGAGNTPVVIDDTADIKLA
VSSIILSKTFDNGMICASEQSVTVLDPIYDEVRSEFERRGCYFVKTGTELESLRGAMFKN
GALDHRIPGMPASDIAALAGITVPAKTKILIAEITSTDAATEEFSHEKLSPVLAMYHAAS
YDEALDKAETLVLAGGPGHTASLYVHPAASEKIEQFQSKMKACRIVINTPSSQGGIGDLY
NFGLTPSLTLGCGSWGGNSISENVGVKHLLNIKTVAERRENMLWFRAPEKVYFKKGSTPV
ALDELGCVMGKKRAFIVTDQFLFKNGNTRAIEAKLDSMGIAHDCFYDVEPDPTLQCVRRG
AKQMSLFDPDVIIAVGGGSAMDAAKIMWVLFEHPDANFEDMAMDFMDIRKRVYTFPEMGK
KAYFVAVPTSSGTGSEATPFAIITDAETGIKWPLADYALLPNMAIVDVDNAMTAPRGLTA
ASGIDVMTHAIESYVSIMASDYTQGFSMRAAKLVFDNLPAAFEKGAADPHAREEMHNASC
MAGMAFANAFLGLNHSMAHKLGAFHHLPHGIANAVILTRVMRYNATEAPVKMGTFSQYPY
PNARAAYAELGRFCGVCGKDDEEVFENFVNRLEELKDLIGVKKTIAEYGVDEKHFLDTLD
DMVEQAFNDQCTGANPRYPLMSEIKELFLDAYYGREPQSYGV
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaaagaagccttcggcaaccactgcccctgaacttgtagattcggtcgaatcc
cttgaggcgaaactcgcgtcgatgcgcgaggcccaagggattttttcaaccttttcacaa
gatcaggtggacaagatcttctacgaggcggcgatggcggccaacaaggcacgcatcccg
ctcgcgcgactcgctgtcgaggagacgggccgcggcgtgctcgaggacaaggtcatcaag
aatcattacgcggcggagtacatctacaacgcctacaagaggaccaagacgtgcggcgtc
atcgagcgcgacgacgcctacggcatcacgaaggtcgccgagcccgtcggcatcgtcgga
gcggtcatcccgacgacgaacccgacgtccaccgcgatcttcaagtgcctcatctgcctg
aagacgagaaacgccatcatcatcagcccgcatccggccgctgcccgatgcaccatcgcc
gcagcgagaatcgtcttggaggcggcggtcgccgccggcgcgcccgagggcatcatcggc
tgggtggacgtgccgtccctggagctcaccaacaaggtcatggcagatgtcgacacgatt
ctggcgaccggaggccccggcatggtcaaagccgcctactcgagcggcaagcccgccttg
ggtgtcggcgcgggcaacacgccggtcgtcatcgatgacacggcagacatcaagctcgcc
gtcagctcgatcatcctgtccaagacgttcgacaacggcatgatctgcgcctccgagcag
tccgtcaccgttctcgacccgatctacgacgaggtcagatccgagttcgagcgccggggc
tgctacttcgtcaaaaccggaaccgagctcgagagcctgcgcggcgccatgttcaagaac
ggcgccctcgatcatcgcatcccgggaatgcccgcgtccgacatcgcggcgctggccggc
atcaccgttcccgccaagaccaagatcctgatcgccgagatcacctccaccgacgcggcc
accgaggagttcagccacgagaagctctcaccggtcctcgcgatgtatcacgccgcgagc
tacgacgaggcgctcgacaaggccgagacgctcgtgctcgccggcggccccggccacacc
gcctcgctgtacgtccatcccgcggcgagcgagaagatcgaacaattccaatccaagatg
aaggcctgccgcatcgtcatcaacacgccctcctcgcaaggcggcatcggcgacctgtac
aactttggtctgacaccctcccttacgctgggctgcggctcgtgggggggcaactccatt
tccgagaacgtgggggtgaagcacttgctcaacatcaagaccgtggcggagcgccgcgag
aacatgctgtggttccgcgcgccggagaaggtgtacttcaaaaaagggagcacgccggtc
gccctcgacgagctcggctgcgtcatgggcaagaagcgcgcgttcatcgtcaccgaccag
ttcctcttcaagaacggcaacacccgcgccatcgaggcgaagctcgacagcatgggcatc
gcgcacgactgcttctacgatgtggagcccgacccgacgcttcagtgcgtgcgacgcggc
gcgaagcagatgagcctgttcgacccggatgtcatcatcgccgtcggcggcggctcggcc
atggatgccgccaagatcatgtgggttctcttcgagcacccggatgcgaacttcgaggac
atggccatggacttcatggacatccgcaagcgcgtctacaccttccccgagatgggcaag
aaagcctacttcgtcgccgtgcccacaagctcgggcacaggttcggaggccacgccgttc
gcgatcatcacagacgccgagaccggcatcaaatggccgctggccgactacgcccttctg
cccaacatggccatcgtcgacgtcgacaacgccatgacggcgccgcgcggcctcaccgct
gcctccggcatcgacgtcatgacccacgcgatcgagtcctacgtctcgatcatggcttcc
gattacacgcagggcttctcgatgcgcgccgcaaagctcgtcttcgacaacctgccggct
gccttcgagaagggcgccgccgacccgcatgctcgcgaggagatgcacaacgcctcgtgc
atggcgggcatggccttcgccaacgcgtttctgggcctcaaccactccatggcccacaaa
ctcggcgcgttccaccacctgccccacggtatcgccaacgccgtcatcctgacgcgcgtc
atgcgctacaatgccaccgaggccccggtcaagatggggacgttctctcagtacccctac
cccaacgctcgagcggcctacgccgagctgggacgattctgcggggtgtgcggcaaagac
gatgaggaggtcttcgagaatttcgtgaacaggctcgaggagctcaaggatctcatcggc
gtcaagaagacgatcgccgagtacggcgtggacgagaagcatttcctcgacacgctcgat
gatatggtcgagcaggcgttcaacgaccagtgcaccggcgcgaatccacgttatccgctc
atgagcgagatcaaggagctgttcctcgacgcctactacgggcgcgaaccccagtcctac
ggggtctga

DBGET integrated database retrieval system