KEGG   Coriobacterium glomerans: Corgl_1069Help
Entry
Corgl_1069        CDS       T01453                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cgo  Coriobacterium glomerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cgo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1231893..1234067
Genome map
AA seq 724 aa AA seqDB search
MKTEVASRDMSAERISAKTDPRATCLMMTEDDIYLLSNGTWQRSWEKMGAHPDTQDGARG
WRFRVWAPLARSVRIVGDFNRWDVDANHLKRILDSDIWEGFIADLKRGELYKFVIETEEG
NLIYKADPYAFFAERAPGTASRLMDLADYAWSDDAWMAARRSADHMKRPLNIYEVHLGSW
RRHGDAPQGEPDENGGYPGPGDSFPAQRGVGYTYDELAEELVAYIVEMGYTHVEIMPIME
HPFDGSWGYQPTGYFAATSRYGEPRQLMHLIDSFHAAGIGVILDWVPGGFCADEHGLSLF
NGHMLYEREIHPNWGTHKFDYSRGEVRSFLVSNALFWIEVFHADGIRMDGVSSMLYLNFG
IDDPALKRTNRFGTEEDLDASAFIRQVNGVVGRAHPDCMMIAEESTAWPLVTYPPEEGGL
GFHYKWDMGWMNDTLHYMQTDFPWRAGNHRLLTFSIMYAFNENFVMPLSHDEVVHGKCSL
IGRMPGDSWRRYAGLRTLLLYQMAHPGAQLNFMGAEIAQTIEWRYYESLQWFLIDESSDH
ARHQVFTRAMNHLFRDEPAFWQRAYAQTGFTWIDADDAAQSIVSFVRHADHIDNDLLFII
NFDPASYESFHLGVPREGVWQVVMDSDDPSFGGSGYPVASSYASLPYPWNGCDDSIDVAL
PGLAGLVFKRIGPSPCAAPHAGSARVEADEPHDKGSARRARSSKKRRGSVREAPEGRRTT
GATR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaccgaagtcgcctcgagggacatgagcgccgagcgcatctcagcgaagacggat
ccgcgcgccacctgcctgatgatgaccgaagatgatatctatctgctctcaaacggcacc
tggcagcgaagctgggagaagatgggggcgcacccggatacgcaagatggcgcgcgcgga
tggcgatttcgcgtttgggctccgctcgcgagaagcgtccggatcgtcggagacttcaat
cgctgggacgtcgacgcgaatcatctgaagcgcatcttggacagcgacatatgggaaggg
ttcatcgccgatctcaagcggggtgagctgtacaagttcgttatcgagaccgaagaggga
aatctgatctacaaagcggacccctatgccttcttcgccgagcgagccccgggcacggcc
tcgcgactcatggacctcgccgactacgcttggagcgacgacgcttggatggcagcgcgg
cgaagcgccgaccacatgaagcggccgctcaacatctacgaggtgcatctgggcagctgg
cgtcggcacggcgatgccccccaaggtgagcccgacgagaacggcggctatcccggtccc
ggcgattcgttccccgcccaacgcggagtaggctacacgtacgacgagctcgccgaagaa
ctcgtcgcatatatcgtcgagatgggctacacccacgttgagatcatgcccatcatggag
catcccttcgacggctcctggggctaccagcccaccggctactttgcggcaacgtcgcgc
tacggcgagccccgccagctcatgcatctcatcgacagcttccatgccgccggcatcggg
gtcatcctcgattgggttcccggaggcttctgcgcagacgagcacggcctgtcgctgttc
aacggacacatgctctacgaacgcgagatccatcccaactggggcacgcacaaattcgac
tacagtcgcggggaggtgcgcagctttctcgtctcgaatgccctgttctggatagaggtg
ttccatgctgacggcattcgcatggacggcgtctcgagcatgctgtacctgaacttcggc
atcgatgatcccgctctgaagcggaccaatcgctttggcacggaggaggatctcgatgca
tccgccttcatccgccaggtcaacggagtcgtcggccgcgcccatcctgactgcatgatg
atcgcagaggagtcgaccgcctggccgctggtgacctatcccccggaggaggggggcttg
ggattccattataaatgggacatgggatggatgaatgacacccttcactacatgcagacc
gactttccctggcgagcgggcaaccatcggctgctcacgttctcgatcatgtacgccttc
aatgagaacttcgtgatgccgctctcccatgacgaggtcgtgcacggcaaatgctctttg
atcgggcggatgcccggggattcgtggagacgctacgccggacttcgcacgctgctgctc
tatcagatggcccaccctggtgcccagctgaacttcatgggcgcagagatagctcagacc
atcgagtggcgctattacgagtccctccagtggtttttgatcgatgagtcgagcgatcat
gcgcgccatcaggtgttcacgcgcgcgatgaaccacctctttcgcgacgagccggcgttc
tggcagcgggcctatgcgcagaccggcttcacatggatcgatgcggacgatgcggcgcag
tcgatagtgtcgttcgtccgccacgccgatcacattgacaacgacctcctattcatcatc
aatttcgacccagcctcatacgagtccttccatctcggcgtcccgcgcgaaggcgtgtgg
caggtcgtcatggactccgatgatccctcgttcggcggcagcggctaccccgtcgcatcc
agctatgcgtcgctaccctacccgtggaatggctgcgacgactctatcgacgtagcgctt
cccggactcgccggtctggtgttcaagcgcatcggtcccagtccatgcgcggcaccccat
gcgggctcggcgcgagtcgaggcggacgagccgcacgacaagggatccgcgcgccgcgcg
cgctcgtcgaagaaacggcgcggttcggtgcgcgaggctcccgaggggaggcggacgaca
ggcgcgacgaggtga

DBGET integrated database retrieval system