KEGG   Coriobacterium glomerans: Corgl_1074Help
Entry
Corgl_1074        CDS       T01453                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cgo  Coriobacterium glomerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Corgl_1074
Enzymes [BR:cgo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Corgl_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1241348..1244647
Genome map
AA seq 1099 aa AA seqDB search
MKLRHNSRSCDCRAPFGAVRAGTTVRLAVHVEDADFASIRLSLRTWVDGRGERIDDMPAV
GNGTFEVSLACPEPEIVWYLFIARAADGTATYLGAPTGRTGGEGVAYASIDAPSFQITVF
QHRAIRPTWYEHGIVYQIFPDRYRRDAGWRERTAAVLDRPRAGIARRLVEDWNEPPSYRR
ANDGSIACWDFYGGSLKGIEDDLQRLAELGVSAIYLNPIFEAASNHRYDTADYLSIDPIL
GTEKDFRHLCAAARERGISIILDGVFNHTGDDSIYFNRYGNYPGAGAWSGPESPWRDAYK
FDDDGGYRCWWGVKNMPDLNQDSPLVRELILGADGVVRHWLRAGARGWRLDVADELSDGF
IADIKRAVMEERPDGLVLGEVWEDASNKSSYGKLRRYLLGQELDSAMNYPFRSMVIDYLL
GVRSARDTAETIESLRENYPPEALACALNLLGSHDKPRIASVLGGGPDESQLPESERGTW
RLDPHAMGLAKGRFWLASLMQMTFPGVPSIYYGDEYGLEGLSDPGNRRTLPDERDVFDHD
MLTIVRNAAALRRALPLMVTGDISAEARSDDVLSYTRRDASGLSATVILNSDCASQHAVS
IPMLGQAASDLISGRELGRNEDGTVTVELAPLGSAVVHFHDRRRMQKPLAPGAGIMCHLT
SMPTEDGRAGRLGAAARRFIDRLHAMGARYWQVLPVNPTDGFNSPYAGPSAFAGSSALLP
GTAGEIERDFESWRDTGGEHDAAFLEFAQTQAAWLAPYCAFMAIKRHMGGASRHEWPARF
KRYDPSLLDDGDLAREARFQAYLQFCFETAWGEMSAYAHERGIEIIGDIPMYVSDESADV
WSAPELFNLDDDGRPTEVAGAPPDDFAPDGQLWGNPTFRWDRMRHDGFTWWLARLRRAQR
LYDHVRLDHFLGYHSYFSIPAGGACSAGRWLPGPGADLFQLAYDAWGPLPFIAEDLGYLT
PGVRALCATCGFPGMDVMQFEDYDVRAGFYPQAGKICYTSTHDTSTLIGFCERSYANGDR
EQARRIAEALLGAALHSDADVVITPLQDILELDDQARMNVPGVAEGNWTWRAREADVIDA
VPRIREMLERSGRISAASR
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgagacataactccaggagctgcgattgccgcgcgcccttcggagctgttcgc
gccggcaccacggtccgtctggcggttcacgtggaggatgccgatttcgcgagcatccgg
ctttcactgcgcacctgggtcgacggcagaggcgagcggatcgatgatatgcctgctgtc
ggaaacgggaccttcgaggtctcgcttgcgtgtccggagcctgagatcgtctggtatcta
ttcatcgcacgtgccgctgacgggaccgctacctatctcggagctcccacggggcgaaca
ggcggtgagggtgtcgcatatgcgtcgatcgacgccccctcgtttcagatcacggtcttt
cagcatcgtgccatacgaccgacttggtacgagcacggcatcgtgtaccagatatttccc
gaccgctaccgccgcgatgccggatggcgcgagcggacggctgcggtgctcgacagaccc
cgcgccggcatcgcgcgccgactcgtcgaggactggaatgaaccgccgagctatcgacgg
gcgaacgacggatcgatcgcgtgctgggacttctacgggggctcgctgaagggcatcgag
gacgatcttcagcgcttggccgaactcggcgtctcggcgatctatctgaatccgatcttc
gaggcggcgagcaaccatcgctacgacacggcggattatctgtcgatcgatcccattctc
ggaaccgaaaaagattttcgtcacctgtgcgcggctgcgcgcgaacggggaatctcgatt
atcttggacggagtattcaatcatacgggggatgactcgatctacttcaaccgctacgga
aactacccgggcgcaggagcctggtccggcccggaatccccatggcgcgatgcgtataag
tttgacgatgacggcggctacaggtgctggtggggcgttaaaaacatgcccgatctcaat
caggattcgcctctcgtccgtgagctcatcctgggagccgacggggtcgtgagacactgg
ctgcgcgccggcgcgcgaggttggcgtctcgatgtcgccgatgagctctccgatggattc
atcgccgatatcaagcgcgctgtcatggaggagcgccccgacggcttggttctcggtgag
gtctgggaggatgcgtcgaacaagtcgagctacggcaagcttcgtcgttatcttttgggc
caggagctcgactccgcgatgaactatccgtttcgctctatggtcatcgattacctgttg
ggcgtcagatccgcccgcgatacggccgagaccatcgaatcacttcgggagaactatcct
cccgaggcgctcgcgtgcgccctcaatctgcttggcagccacgacaagccccgtatcgca
tctgtgctcggcggcggtccggacgagtcccagctgcccgagagcgagcggggtacctgg
cggctcgatccgcacgcgatgggactcgcaaaaggacgcttctggctcgcctcgctcatg
cagatgacgttcccgggagtcccctcaatctactacggtgatgaatacggtcttgagggg
ctatcggatccgggcaatcgacggacactgcctgatgagcgcgatgtcttcgatcatgat
atgctcaccatcgtgagaaacgccgcggcgctgcgccgggcgctgcctctgatggtgacc
ggtgacatctctgccgaagcgcgctcagatgacgttttatcatacacgcgtcgcgacgcg
agcggactcagcgcgacggtaattctcaacagcgactgcgcctcgcagcacgccgtgagc
atccccatgctcggccaggccgcctcagatctgatctcgggcagagagctcggtcgcaac
gaggacggcaccgtgacggtggagctcgcaccgctcggttccgcggtcgtgcacttccat
gatcggcgacgcatgcagaagccgcttgccccgggagcgggaatcatgtgccatctcacc
tcgatgccgaccgaggacggtcgggcaggtcgtctcggtgccgctgcacggcgcttcatc
gaccgactccacgcgatgggtgctcgctactggcaggtcctgcccgtgaatcccactgat
ggcttcaactcgccgtatgcgggaccctccgcgttcgcgggcagctctgcgcttctgccc
gggacggctggcgagatcgagcgggatttcgagagctggcgcgacacgggaggagagcac
gacgccgcgtttctggagtttgcgcagacgcaggcggcttggttggcaccctattgcgct
ttcatggccatcaagcgccatatggggggtgcatcgcgccatgaatggcccgctcgcttc
aagcgctacgatccctcgctgctcgacgacggcgatctcgctcgggaggcgcgattccaa
gcgtatctccaattctgtttcgagaccgcatggggagagatgagcgcgtacgcgcacgag
cgcggcatcgagatcatcggggatatcccgatgtacgtctccgacgaatcggccgatgtc
tggagcgcaccggagctgttcaatcttgatgatgacggcaggccgaccgaggtcgcggga
gctccgccggacgacttcgcacccgacggacagctctggggcaacccgacgtttcgctgg
gaccggatgagacatgatggattcacctggtggctcgcgagactgcgacgcgctcaacga
ctttacgaccatgtccgactcgaccactttttaggctatcactcgtatttcagcattccg
gctggcggtgcgtgctccgcgggacgctggctgccgggaccgggagcggatctgttccaa
ctcgcctacgacgcatggggtccgctgcccttcatcgcggaggatctgggctatctcacg
cccggtgtgcgcgcgctgtgcgcgacatgcggctttccgggcatggacgtcatgcagttc
gaggactatgacgtccgcgccggcttttatcctcaagccggaaagatctgctacacgtcg
acccatgacacttcgaccctcatcggcttctgcgagcgctcctacgccaacggggatcga
gaacaggcgcgtcgcatcgcggaagcacttcttggcgccgcgctccacagcgatgcggat
gtcgtgatcacgccgcttcaggacattcttgagctggatgatcaggcgcgcatgaacgta
ccgggggtggccgagggaaactggacatggagagcgcgcgaagccgatgtgatcgacgcc
gtcccacgcattcgcgagatgctcgagagaagcggtcgcatcagcgcggcgagccgatga

DBGET integrated database retrieval system