KEGG   Coriobacterium glomerans: Corgl_1201Help
Entry
Corgl_1201        CDS       T01453                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cgo  Coriobacterium glomerans
Pathway
cgo00300  Lysine biosynthesis
cgo01100  Metabolic pathways
cgo01120  Microbial metabolism in diverse environments
cgo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Corgl_1201
Enzymes [BR:cgo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Corgl_1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M28 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEB07304
JGI: Corgl_1201
UniProt: F2N8C1
Position
complement(1406004..1407419)
Genome map
AA seq 471 aa AA seqDB search
MIDHKLEAQVDAYVKEIWEDAIADIGQLVAHPSVSDVSAAEQGAPFGRPVREALDAALRI
ARRLGYETSDDDGYIGIADIAGQRSAHIATIAHIDVVPAGPGWRTDPFALERRDGWLLGR
GALDDKGPAVLSLYAGAFLRRQGGAPRYGFRALLGCDEEAGMRDVDHYLDSHENPAFLFT
PDAAFPVCNAEKGNYNAEFKSAPISSGRILFWSGAAAGNAIPGESIIELAVDAEKLPAPR
EHADRIGIEPVRQGVSRIVARGIGGHASLPEGTMNAIGIIVGYLRASHVVDGEEARFLEL
LSKVLADTSGTQLGIASENEAFGALTLNGGTIEVRDGRIVQSIDIRYPDSTSAAAITERL
SALAADFGAEFRVASSKPPFSVDADDPAVRALIDVYGDVTGTRAEPFSMGGGTYARKFAR
AVSFGPEEEDLVAPEWIGSMHGPDEGASERSLRRALKIYILAILRLQELEL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcacaagctcgaggcacaggtagatgcctacgtaaaggagatctgggaggat
gcgatcgcggatatcgggcagttggtggcacatccttccgtgagcgacgtctccgcagcc
gagcagggagcgcccttcggccgcccggtgcgcgaagccctggacgccgcgctgcgcatc
gcgcggcggctcggatacgagacctccgatgatgacggctacatcggcatcgccgacatc
gccggccagcgctccgcgcacatcgccacgatagcccacatcgatgtggtaccggccggc
ccgggctggcgcaccgatccattcgctctggagcgccgggacggctggttgctcgggcgc
ggcgccctcgacgacaagggcccggcggtgctgtcgctgtacgccggagccttcctcagg
cgacagggcggcgcgccccgctatggatttcgcgcgctgctcggctgcgacgaggaggcc
ggtatgcgcgatgtcgaccactatctcgactctcacgagaaccccgcgttcctgttcacg
ccagatgcggcgtttccggtgtgcaacgccgagaagggcaactacaacgccgagttcaaa
agcgctccgatctcctcgggccgcatcctgttctggagcggcgccgcggccggaaacgcg
atccccggcgagtcgatcatcgagctggcggtcgacgccgagaagctgcccgcgccgaga
gagcacgccgaccgcatcggcatcgagccggtgcggcagggtgtctctcgcatcgtggcg
aggggaatcggcggtcacgcctcgcttccggagggcaccatgaacgcgatcggcatcatc
gtgggctatcttcgcgcgagccatgtcgtcgacggggaggaggcgcgcttcctcgagctg
ctctcgaaggtgctggccgacacctccgggacgcagctgggcatcgccagcgagaacgag
gcattcggcgccctcacgctgaacggcggcaccatcgaggtgcgcgacggccgcatcgtc
cagtctatcgatattcgctaccccgacagcacgagcgcagcggccatcacagagcggctc
tcagcgctcgcggccgacttcggtgccgagtttcgcgtcgcctcgtcgaaaccgcccttc
tcggtggatgcggacgatccggcggtgcgcgccctcatcgacgtgtacggcgacgtcacc
ggcacgcgcgccgagccgttctccatgggcgggggcacctatgcgcgcaagttcgcccgt
gctgtctcgttcggaccggaagaagaggatctcgtcgccccggagtggatcggctccatg
cacggtccagacgagggcgccagcgagcggtccctgcgtcgagcgctcaagatctacatt
ctggccatcctgcgcttgcaggagctcgagctgtga

DBGET integrated database retrieval system