KEGG   Coriobacterium glomerans: Corgl_1253Help
Entry
Corgl_1253        CDS       T01453                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cgo  Coriobacterium glomerans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Corgl_1253
   01230 Biosynthesis of amino acids
    Corgl_1253
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Corgl_1253
   00051 Fructose and mannose metabolism
    Corgl_1253
   00562 Inositol phosphate metabolism
    Corgl_1253
Enzymes [BR:cgo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Corgl_1253
Exosome [BR:cgo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Corgl_1253
  Exosomal proteins of bladder cancer cells
   Corgl_1253
  Exosomal proteins of melanoma cells
   Corgl_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1468549..1469328)
Genome map
AA seq 259 aa AA seqDB search
MQSRRTRLIAGNWKMNNGIGEAAVLASRLGELVGTAPEGVEVLVCPPTIDLSVVADKIEG
TDIRLGAQNCYWEKSGAYTGETAPGMIRGVGALYCIIGHSERREYFGETDADEMRKARAL
IDAGITPVFCCGESESVRESGSQVAFVCDQIKAGLAGIELARADQLVVAYEPIWAIGTGK
TATAADAQEVCGAIRKTLAELFGEQIAEGVRVLYGGSAKPGNIAEFLAERDVDGALVGGA
SLVAEDFAAMVARAGEHLA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtagacgcacccggctcatcgccggcaactggaagatgaacaacggcatcggc
gaggccgcggtgctcgcctctcggctcggcgagctcgtcgggaccgcaccggagggcgtc
gaggtgctcgtgtgcccgccgaccatcgacctgagcgtcgtggccgacaagatcgagggc
accgacatcaggctcggcgcccagaactgctactgggaaaaatccggcgcctacaccggc
gagacggcaccggggatgatccgcggcgtcggcgcgctctactgcatcatcggccattcg
gagcgtcgggagtacttcggcgagaccgacgccgatgagatgcgcaaggcccgcgccctg
atcgacgccggcatcacgccggtgttctgctgcggggagtccgaatcggtccgcgagtcg
ggctcgcaggtcgcgttcgtgtgcgaccagatcaaagcgggtctggccggcatcgagctc
gcccgcgccgaccagctggttgtcgcctacgaacccatctgggccatcggcaccggcaag
accgcgacggccgccgacgcccaggaggtctgcggcgcgatccgcaagaccctcgctgag
ctgttcggcgagcagatcgccgagggggtccgcgtgctctacggcggctcggccaagccc
ggcaacatcgccgagttcctggcggagcgagacgtcgacggcgcactcgtcggaggcgct
tcgcttgttgccgaggacttcgcggccatggtcgcacgagcgggggagcatctggcatga

DBGET integrated database retrieval system