KEGG   Coriobacterium glomerans: Corgl_1253Help
Entry
Corgl_1253        CDS       T01453                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cgo  Coriobacterium glomerans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Corgl_1253
   01230 Biosynthesis of amino acids
    Corgl_1253
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Corgl_1253
   00051 Fructose and mannose metabolism
    Corgl_1253
   00562 Inositol phosphate metabolism
    Corgl_1253
Enzymes [BR:cgo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Corgl_1253
Exosome [BR:cgo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Corgl_1253
  Exosomal proteins of bladder cancer cells
   Corgl_1253
  Exosomal proteins of melanoma cells
   Corgl_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1468549..1469328)
Genome map
AA seq 259 aa AA seqDB search
MQSRRTRLIAGNWKMNNGIGEAAVLASRLGELVGTAPEGVEVLVCPPTIDLSVVADKIEG
TDIRLGAQNCYWEKSGAYTGETAPGMIRGVGALYCIIGHSERREYFGETDADEMRKARAL
IDAGITPVFCCGESESVRESGSQVAFVCDQIKAGLAGIELARADQLVVAYEPIWAIGTGK
TATAADAQEVCGAIRKTLAELFGEQIAEGVRVLYGGSAKPGNIAEFLAERDVDGALVGGA
SLVAEDFAAMVARAGEHLA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtagacgcacccggctcatcgccggcaactggaagatgaacaacggcatcggc
gaggccgcggtgctcgcctctcggctcggcgagctcgtcgggaccgcaccggagggcgtc
gaggtgctcgtgtgcccgccgaccatcgacctgagcgtcgtggccgacaagatcgagggc
accgacatcaggctcggcgcccagaactgctactgggaaaaatccggcgcctacaccggc
gagacggcaccggggatgatccgcggcgtcggcgcgctctactgcatcatcggccattcg
gagcgtcgggagtacttcggcgagaccgacgccgatgagatgcgcaaggcccgcgccctg
atcgacgccggcatcacgccggtgttctgctgcggggagtccgaatcggtccgcgagtcg
ggctcgcaggtcgcgttcgtgtgcgaccagatcaaagcgggtctggccggcatcgagctc
gcccgcgccgaccagctggttgtcgcctacgaacccatctgggccatcggcaccggcaag
accgcgacggccgccgacgcccaggaggtctgcggcgcgatccgcaagaccctcgctgag
ctgttcggcgagcagatcgccgagggggtccgcgtgctctacggcggctcggccaagccc
ggcaacatcgccgagttcctggcggagcgagacgtcgacggcgcactcgtcggaggcgct
tcgcttgttgccgaggacttcgcggccatggtcgcacgagcgggggagcatctggcatga

DBGET integrated database retrieval system