KEGG   Coriobacterium glomerans: Corgl_1273Help
Entry
Corgl_1273        CDS       T01453                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cgo  Coriobacterium glomerans
Pathway
cgo00051  Fructose and mannose metabolism
cgo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Corgl_1273
Enzymes [BR:cgo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Corgl_1273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Amidase02_C
Motif
Other DBs
NCBI-ProteinID: AEB07374
JGI: Corgl_1273
UniProt: F2N8J1
Position
complement(1496994..1497659)
Genome map
AA seq 221 aa AA seqDB search
MIMEQQRTQIVKFGRKMSASGLCVGTSGNISVFDPRTGYLCISPSGLGYFETEPEDIVVM
DLAGNVIEGERKPSSEHGLHTIVYLNRPDARAVVHTHSPFATTLASMHETLKPAHYAMMG
AAVYEIPLVEYETFGSAELASAVEMALRATPATRALLLANHGDVCLHESLSKAFALAENI
EFTSRVQWQCACAGRPVYLTRDQFARALERSRTYGQVPNGR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatcatggaacagcagcgtacacagatcgtgaagttcggcagaaagatgagtgcgagc
ggtctgtgcgtgggcacgagtggcaacatttcggtcttcgacccgcggaccggatatctg
tgcataagcccgtcggggctgggctacttcgagaccgagccggaggatatcgtggttatg
gatcttgccggtaatgtgatagagggcgaacgaaagccctcgtctgagcacggactccat
accatcgtctatctgaatcgtcccgacgcccgcgcggtcgtgcacacccactcgccgttc
gccaccacgctggcctcgatgcatgagacgctcaagccggcgcactacgccatgatggga
gccgctgtctatgagatcccactcgtggagtatgagacattcgggtcagcggaactcgcc
tccgctgtcgagatggcgctgcgtgcgactccggcgactcgagcgctgctgctcgccaat
catggagacgtctgtcttcatgagagtctgtcaaaggcgttcgccttggctgagaacatc
gagttcacctcgcgcgtccaatggcagtgcgcgtgtgcgggtcgtccagtttatctcacg
cgtgaccagttcgcacgcgcgctcgagcggtctaggacctatggtcaggtgccaaatggc
cgatag

DBGET integrated database retrieval system