KEGG   Coriobacterium glomerans: Corgl_1384Help
Entry
Corgl_1384        CDS       T01453                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cgo  Coriobacterium glomerans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Corgl_1384
  Lipid metabolism
   00561 Glycerolipid metabolism
    Corgl_1384
   00600 Sphingolipid metabolism
    Corgl_1384
Enzymes [BR:cgo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Corgl_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1610756..1612495)
Genome map
AA seq 579 aa AA seqDB search
MDDPRGGSFAKTLPIVDIDADPRFTLRWRSLPDGSSHLVNWSGADRPACCEMGLEVRSTC
SSEPGGVAHRTWSIEVRPNKTIEILDVKATVDAPIARADAVFLNGYQSWTDSVERRPTAR
VRGLDRVPRFIVDRYVLDGSGDYRFTRYDHRRGHQHGFCYGYIRRADMVALVGSLEEDSG
FTVLRTSTAENELTLEKEPPSRPLAAGEFRRLMAFAICQGAREEAVARWLVLAGIRPLPA
PPLVGYSSWYRRYGDIDAESLLDDLKGATHVLCDIDLGPAQRVFQIDDGYSKVGDWLEFD
RSRFPLGPATVLSAAREEGFIPGIWLAPFVCERDSELYAAHPDWLLSDAFGSEVRTGCNW
SGAVALDTRNSEVRDYIAKVISTVTANWGAELLKLDFLFAACMIAHDGLNRGELMADALE
LLRESAAPRTRMILCGVPLASAFGKAEYCRIGCDVGLDWDDRFYMRLLHRERISTKNSLR
NTYGRAHLDGRAFRCDPDAFFLRAGDVNLTTKQKESLLEADIVCGGVLLTSDDMGAWTAD
QIECYRAAVRAFAAKEDGAIREAGNENGLLNCSPSSSRS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggacgacccgcgtggcggctccttcgcaaaaacgcttccgattgtcgatatagatgcc
gatccacggttcacgctcaggtggaggtcgcttcctgatggctcgtcgcatctggtgaac
tggtcgggagcggatcggcccgcctgttgcgagatgggtctcgaggtgcgctccacgtgt
tcctcggagcccggcggcgttgcccacaggacttggagcatcgaggtcagaccaaacaag
accatagagattctcgatgtcaaggcaacggtcgatgcgcccatcgctcgagctgatgcc
gtctttctgaatggataccagtcttggaccgatagcgtcgagcggcggccgaccgcgcgt
gtccgcgggctcgatcgagtgccgcgattcatcgtggatcgatatgtgctcgatggcagc
ggagactatcgattcacccgatacgatcatcggcgggggcaccaacatgggttttgctac
ggctacatccgcagggccgacatggttgcactcgtcggatcgctcgaggaggacagcggt
ttcaccgtattgaggacctcgacggccgagaacgagctgacgcttgagaaagagccccct
tcgaggccgctcgccgcaggtgagttccgtcgcctcatggcattcgccatatgtcagggc
gcgcgcgaggaggccgtcgcccgatggctcgttctggcgggtattcgtccccttcccgcc
ccgccactggtaggttattcaagttggtatcgtcgctatggagatatcgatgccgaatcg
cttcttgatgatctcaagggcgcgactcatgtgctctgtgacatcgatctgggtcccgct
cagcgcgtttttcagatagacgatggatattcaaaggtgggagattggctggagttcgac
cgatcgcgctttccgctgggccctgcgaccgtcttgagtgcagcgcgtgaagagggcttc
attcccggcatctggctcgctccgttcgtatgcgagcgtgattccgagctgtatgcggcg
cacccggactggcttttgagcgacgcgttcgggtccgaggtgagaaccggctgcaactgg
agcggcgcggtcgcactcgatacgagaaattccgaggttcgtgactacatcgcaaaggtg
atctcaacggtgaccgcgaattggggagccgagctgctcaagctcgatttcctgttcgcg
gcatgcatgatcgcccatgacgggctcaatcgaggggagctgatggctgatgctctcgag
cttctgcgggaatccgctgctccgcggacacgcatgattctttgtggcgtgccgcttgca
tcggcattcggcaaggcagagtactgtcgtatcggctgcgatgtcggcttggattgggac
gataggttctatatgcggctgctccaccgagagcgcatcagcacgaagaacagccttcgc
aacacgtacggtcgcgcccacttggatggtcgcgcatttcgctgcgatccagatgcgttc
ttcttgcgcgccggcgatgtgaatctcaccaccaagcaaaaagagagtctgctcgaggcc
gatatcgtctgcggcggtgttcttctcacttcggatgacatgggcgcatggacagctgat
cagatagaatgctatagggctgccgtcagggcgttcgccgccaaagaggacggcgcgatt
cgagaagccggtaacgagaacggccttctcaactgcagcccctcgagttcgagatcctag

DBGET integrated database retrieval system