KEGG   Coriobacterium glomerans: Corgl_1389Help
Entry
Corgl_1389        CDS       T01453                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cgo  Coriobacterium glomerans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Corgl_1389
Enzymes [BR:cgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Corgl_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1617413..1618327)
Genome map
AA seq 304 aa AA seqDB search
MHKVIVFGSLNMDLTIACERMPLAGETISGGGFLANPGGKGANQAVAAAKLGAQTQMIGA
VGQDTFGDQLIAALAEAGVECKCVERVSGRPTGVACIVRVGPDNRIIVDPGANDVLRAED
VSHALDRLAGPGDIFLTQLECDHATTFAALAKARSRGMYVVLNAAPARTLPDDIWSNIDL
VCINETECAAITGVYPDCDEAALRAMRQLADKGVHLVAVTLGERGAILLEDGRKLVSEPF
HVNAIDTTCAGDTYLGAFIAARARGMSTEEIIRWSSCASALATTRIGAQQSIPSIAEVER
LLTR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcataaggtaatcgttttcggcagcttgaatatggatctgactatagcgtgcgagcgc
atgccgcttgccggagaaacgatctccggcggcggctttcttgccaatcccggtggcaag
ggggcgaatcaagccgtcgccgccgctaagctcggcgcccagacacagatgatcggtgct
gtcggccaagatacgttcggcgatcagctgatcgccgctctggctgaggccggggtggag
tgcaagtgcgttgagcgcgtgtccggcagacctaccggggtggcatgcatcgtgcgcgtc
gggccagacaaccgcatcatcgtagatcccggtgcgaacgatgtcttgcgagcggaggat
gtctcgcatgctctcgatcgcctcgctggtcccggggacatctttctcactcagctcgag
tgcgaccatgcgaccacgtttgccgcccttgccaaggcccgctcccgcgggatgtatgtc
gtcttgaatgctgcgcctgcgagaacgctgcctgatgacatctggtcaaatatcgatctg
gtctgcatcaacgaaaccgagtgcgcggccatcacaggagtctatcccgactgcgacgag
gccgctttgagagcgatgcgacagctggcagataaaggcgtacatcttgtcgccgtcacg
cttggtgagcgtggtgcgattcttcttgaggatggccgcaaactcgtctcagagccgttt
catgtgaacgctatcgacaccacgtgcgcgggggatacctatctcggtgccttcatcgcg
gcccgagccagagggatgtccaccgaggagatcatccggtggtcatcgtgcgcctctgcg
ctcgcgacgactcggatcggcgcgcagcagtccataccctccatcgccgaggttgagcgc
ctcctgacccgatag

DBGET integrated database retrieval system