KEGG   Coriobacterium glomerans: Corgl_1399Help
Entry
Corgl_1399        CDS       T01453                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cgo  Coriobacterium glomerans
Pathway
cgo00900  Terpenoid backbone biosynthesis
cgo01100  Metabolic pathways
cgo01110  Biosynthesis of secondary metabolites
cgo01130  Biosynthesis of antibiotics
Module
cgo_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Corgl_1399
Enzymes [BR:cgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Corgl_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEB07500
JGI: Corgl_1399
UniProt: F2NAP4
Position
complement(1627272..1628171)
Genome map
AA seq 299 aa AA seqDB search
MIERAIRVFAPAKVNLYLGVHAQTDARGYHRVDSVMAALDLTDTVTVAPASDSTLTVRMR
PNLDVATERNTAHRAAAALGRAFGRKPCVEIEVEKRIPIRAGLGGPSADAAAVIVGMCRA
WGIDPADERVRATARGIGADVPFLLSGALVYCDEAGDRPAEIFEPLGGLAVALVKPISTG
VTAAEAYARFDRAPVPPAPIDPMLEALREHDGAGVARHISNNLRAASCELDPQIGHVLEW
MRSRSEARAVELTGSGSCVYALCDTIETADAIAIAAERERGWWSCAAKMKKSRLSASDV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacgggcgatcagagtttttgctcccgccaaagtcaatctctatctcggagtt
cacgcgcaaacggatgcacgcggttaccaccgagtcgattctgttatggctgcgctcgat
ctgaccgataccgtgaccgtggcacccgcatcggactcgacgctgacggtgcgcatgcgg
ccgaacctcgacgttgcaaccgagcgcaacaccgcgcatcgcgcggctgcggctctcgga
cgggcatttggccgaaagccctgcgtcgagatcgaggtcgagaagcggattccgattcgc
gcgggattgggcgggccctcagctgatgcggcggcggtcatcgtgggcatgtgtcgagcc
tgggggatcgatccggccgatgagcgagtgcgcgcaacagcgcgcggcatcggcgcggat
gtgccgtttctgctgtctggtgcgctcgtctactgcgacgaggcgggagatcgccctgcg
gagatattcgaacctctcggcggtcttgccgtagcgcttgtgaagccgatatcgacaggt
gtcaccgcggcggaggcctacgcgcgcttcgatagggccccggtgcctcccgcgccgatc
gatccgatgctcgaggcgctgagagaacatgatggtgccggcgtcgcccgtcacatctcc
aataaccttcgagcggcatcatgtgagcttgatccgcagatcggacacgtgctcgagtgg
atgcgctcccgatctgaggcccgcgcggtcgagctcaccggatccggttcgtgcgtctac
gcactatgcgatacgatcgagacggcggacgcgatcgccatcgccgccgaacgcgagcgc
ggatggtggagctgcgccgcaaagatgaaaaagtcccggctctccgcgtctgacgtctag

DBGET integrated database retrieval system