KEGG   Coriobacterium glomerans: Corgl_1475Help
Entry
Corgl_1475        CDS       T01453                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cgo  Coriobacterium glomerans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Corgl_1475
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Corgl_1475
   00052 Galactose metabolism
    Corgl_1475
   00500 Starch and sucrose metabolism
    Corgl_1475
   00520 Amino sugar and nucleotide sugar metabolism
    Corgl_1475
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Corgl_1475
   00524 Butirosin and neomycin biosynthesis
    Corgl_1475
Enzymes [BR:cgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Corgl_1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1720247..1721203)
Genome map
AA seq 318 aa AA seqDB search
MARTAGFYIGLDVGGTTVKEGLLTAQGELIAREVVPTPPLTDAVGYAAVTGGIDRLLAQA
AAAPEDVRGIGLAVPAPVPSDGRIKVAANIKLDLDGLRDALRESCPAAAVTFENDANAAA
MGELWVGSARGTDSFVFVTIGTGVGGGVVHAGRVVSGVAGAAGEIGHMCLNPEETRPCGC
GGHGCLEQYASATGIVRSYLAACRSAGVEPVPLAGPSDSRAVFEAARDDDAAAASAIETM
CDYLGRALALVACVIDPEAFVLGGGTSNSSDLFLERLVECYRSYALICSADTPIEIASLG
NDAGIFGAAYVALQASRR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaccgcagggttctatatcggcttggacgtgggcggcacgacggtcaaggag
ggtctgctcaccgcgcagggggagctgatcgcgcgcgaggtcgtgcccacgccgccgctg
accgatgcggtcggatacgccgccgtcaccgggggcatcgatcgtctgcttgctcaagcc
gctgcggctcctgaagacgtgcgaggtatcggtctggcggtccccgccccggttccctcg
gatggtcgcatcaaggtcgccgcgaacatcaaactcgatctcgacggtctgagagatgcg
cttcgcgagagctgcccagctgcggccgtgacattcgaaaatgacgccaacgcagccgcg
atgggcgagctttgggtcggcagcgcgcggggcaccgacagcttcgtgttcgttacgatc
ggaaccggtgtcggaggcggagtcgtccacgccggccgtgttgtgtccggggtcgccgga
gcagctggtgagatcggccatatgtgtctgaatcccgaagagacgcgtccgtgcggctgc
gggggccatgggtgcctggagcaatacgcctctgccaccggtatcgtccgcagctatctc
gcggcgtgccgatcagcgggcgtcgagcccgtcccgctggcggggccgagcgattcccgc
gccgtcttcgaggcggctcgcgatgacgacgccgccgccgcgagcgcgatcgagaccatg
tgcgactatctggggcgtgctctcgcgctcgtcgcctgcgtcatcgacccggaggcgttc
gttttgggcggggggacgtccaactcctcggatctcttcttggagcgactcgtcgagtgc
tatcgaagctatgctctgatctgctcagccgatacaccgatcgagatagcatcgctgggt
aacgatgccggtatcttcggtgccgcctacgtggctctccaggcgtcgcgtcgctag

DBGET integrated database retrieval system