KEGG   Coriobacterium glomerans: Corgl_1536Help
Entry
Corgl_1536        CDS       T01453                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cgo  Coriobacterium glomerans
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cgo00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1794941..1796734
Genome map
AA seq 597 aa AA seqDB search
MHTFEIGSDFYMDGRPFQIRSGAIHYFRLHPDDWEHSLYNLKAMGFNTVETYIPWNMHEP
HKDEFRITAETDFERFLGLASDLGLWAIVRPSPFICAEWEFGGLPAWLLAERGMRIRSND
PRFLERLALYYDMLMPHLAKHQITRGANIIMMQIENEYGSYCEDSDYMRSVRDLMVERGI
DVKLCTSDGPWRACQRAGSLIEDNVLATGNFGSHATENFAALKGFHKEHGKTWPLMCMEF
WAGWFNRWGESVVRRDPEELARSVREALREGSINLYMFHGGTNFGFMNGCSARHDHDLHQ
ITSYDYDAPLDEAGNPTEKFYALQRMVREDFPDARTASPRIKGTLAPMTLERCGLAGLFE
TLDTLSEPLEMRHPAAMEDLGQAYGYILYRTRIEADTAGEERFRIVDARDRAQLFLNGRL
VATQYQEDIGEDILAAPKPGINQLDILVENMGRVNYGHKLLASTQHKGIRTGICVDLHFV
TGFEVFRLPLASADKVDFSRGWTPGAPAFHRFAAVVRDTALDTHLDLTGFGKGCVFVNGF
NVGRFWEKGPTRSLYVPHGLLRVGSNDIIVFETEGIYSDELKLSSRPVIDERAGEER
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
gtgcatacattcgagatcggctctgatttctatatggatgggcgtccttttcagatcaga
agcggtgcgatccattatttccgcctgcacccagacgactgggagcattcactttacaat
ctcaaagccatgggcttcaacacagtcgaaacatatataccatggaatatgcatgagccg
cacaaagatgaattccgcatcaccgccgagacggacttcgagcgcttcctggggctcgca
tcagatctcggcctctgggcgatcgtgcggccctcccccttcatttgcgccgaatgggag
ttcggcggcctgccagcatggctgctggccgagcgcggcatgcgcatccgctcaaacgac
ccgagatttctcgagcgtctggccctctactatgacatgctcatgcctcatctggccaag
caccagatcacgcgtggggccaatatcataatgatgcagattgaaaacgagtacggctca
tattgcgaggacagcgactacatgcgctccgttcgcgatctcatggtcgagcgaggcatc
gatgtgaagctgtgcacctcagacggaccatggcgtgcctgtcagcgcgccggatcgctt
atcgaagacaacgtcctcgccaccggaaacttcggatctcatgcgacggagaactttgcc
gcgctcaagggattccacaaagagcacggcaagacctggccgctcatgtgcatggaattc
tgggctggctggttcaatcgatggggcgagtcggtcgtgcgacgcgatccggaagagctt
gcccgaagcgttcgcgaagccctgcgcgagggaagcatcaatctctatatgttccatggc
ggcacgaatttcggttttatgaacgggtgctcggcacgacatgaccatgacctgcaccag
atcacgagctacgattatgacgccccgctcgatgaggcgggcaacccgaccgagaagttc
tacgccctgcaacgcatggtgcgtgaggacttccccgacgcgcggaccgcctcgccgcgg
atcaagggcacgctggctccgatgacgcttgagcgctgcggcctcgccggcctgttcgaa
acactcgacacgctctccgagcccttggagatgcgccatcccgcggccatggaggacctc
gggcaggcatacggctacatcctgtaccgcacgcgcatcgaggcggacacagccggtgag
gagcgcttccgcatcgtcgacgcacgcgaccgcgcccagctcttcctcaacggccggctt
gtggcgacccagtaccaggaagacatcggcgaggacatcttggccgcaccgaagccgggt
atcaatcagctcgacatcctcgtcgagaacatgggtcgtgtcaactacggccacaagctg
ctcgcgtcaacccagcacaagggcatccgaacgggtatctgcgtcgatctgcacttcgtg
acaggcttcgaagtgttccggctgccgctcgcatccgccgacaaggtggatttttcccgg
gggtggaccccaggggcaccggcgtttcatcgcttcgctgcggttgtccgggacacggct
ctcgacacgcatctggacctcaccggtttcggcaagggctgtgtgtttgtaaacggcttc
aatgtaggtcgattctgggagaagggccccacgcggagcctgtatgttccccatggcctg
ctgcgagtgggatcgaatgacatcatcgtcttcgagaccgaggggatctattcggacgag
ctcaaactgagctcaaggcctgtgatcgacgaacgggccggagaggagagatag

DBGET integrated database retrieval system