KEGG   Coriobacterium glomerans: Corgl_1610Help
Entry
Corgl_1610        CDS       T01453                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cgo  Coriobacterium glomerans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cgo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1882094..1883599)
Genome map
AA seq 501 aa AA seqDB search
MLSAMARYIIGIDQSTQGTKALLLDERGTLIRRVDRPHRQIVSDSGWISHDPREIARNVI
RSSRDVVLAEGIPLGEVAGIGISNQRETTVAWDARTGEPLCDAVVWQCARASEICARIKA
KEGASEMVRARSGLPLSPYYPASKMAWILENVSSASEAARSGSLRMGTVDSWIIWVLTHG
TAFLCDHSNASRTQLFDIAALGWSQELCSLFGIDESCLPAVTDSDACFGYTDLEGFLPTP
IPIHAALGDSHAALFGQGCLKRGMAKATYGTGASVMLNVGARPIASAHGLSTSIGWRMGA
TETYVIEGNINYAGAVNTWLRDDLGLIDAPSEVEALCRSASRASRVYLVPAFSGLGAPHW
CDRAQAAILGMERSTHRAELVCAANESIAYQIADVVDAMREDAGIVLSELRVDGGPTANG
YLMQFQSDVLATPLRVAKNDEMSGMGAAWCAGVSLDIYGRDVAVDSAPRARFEPKMRPDE
RQSRIAGWRRALATTIGYARD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagcgccatggcgcgctatatcatcggcatcgatcagtccacgcagggaaccaag
gctctgttgctcgatgagcggggcactctgatacggcgcgtcgatcggccgcaccgccag
atcgtgagcgatagcggatggatcagccatgatcctcgcgagatcgcgcgcaacgtgatc
agatccagtcgggatgtcgtgctcgccgaggggattccgctcggggaggtagcaggcatc
ggcatctcaaaccaacgcgagaccacagtcgcatgggacgcccgtaccggagagccgctg
tgcgatgccgtggtgtggcaatgcgcgcgcgcgagcgagatctgcgcgcgcatcaaggcg
aaggaaggcgcatcggagatggtgcgcgcacgcagcgggctgcctctgtcgccgtattat
ccggcgtcgaagatggcatggatcttggagaacgtgagctcggcctcagaggccgctcgc
tccggaagcctgcggatgggaacggtagacagctggatcatctgggtgctcactcacgga
accgcgtttttgtgcgaccattccaacgcgagccgcacgcagcttttcgacatcgccgca
ctcggctggtcccaggagctgtgctcgctgttcggcatcgatgaatcgtgcctgcccgct
gtgaccgattccgacgcgtgcttcggatacaccgatctggagggctttctccctacgccg
attccgatccacgcagcgctgggtgacagccatgccgctctgttcggacagggttgcctg
aagcgcggcatggcaaaggcgacctacggtaccggtgcgtcggtcatgctcaatgtcggt
gcgcggccgattgcgagcgcgcacggactgtcgacgtcgatcggatggcggatgggcgcg
acggagacctatgtgatcgagggcaatatcaactacgcgggagctgttaacacctggctc
agggatgatctcgggctcatcgacgctccgagcgaggtcgaggcgctctgccggtctgca
tcccgggcgagtcgcgtctatctcgttcccgcattcagcggactcggtgcgcctcattgg
tgcgatcgggcgcaggccgcgatcttgggcatggagcgcagcacgcatcgggcggagctg
gtctgcgcggcaaatgagagcatcgcctaccagatcgcagatgtggtggacgccatgcgc
gaggacgctggaatcgtcctgtcggagctgcgcgtcgatggcggccccactgccaacgga
tatctcatgcagtttcaatccgacgtgctcgccacaccgctgcgggtcgcaaagaacgac
gagatgagcggcatgggtgccgcgtggtgcgctggagtctctctggacatctacggtcgc
gatgtcgcagtcgattccgcgcctcgagcccgattcgagccgaagatgcggccagatgag
cgccagagccgtatagcaggatggcgtcgagctctcgcgaccacgatcggttatgcccgc
gactga

DBGET integrated database retrieval system