KEGG   Coriobacterium glomerans: Corgl_1610Help
Entry
Corgl_1610        CDS       T01453                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cgo  Coriobacterium glomerans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Corgl_1610
Enzymes [BR:cgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Corgl_1610
Exosome [BR:cgo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Corgl_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1882094..1883599)
Genome map
AA seq 501 aa AA seqDB search
MLSAMARYIIGIDQSTQGTKALLLDERGTLIRRVDRPHRQIVSDSGWISHDPREIARNVI
RSSRDVVLAEGIPLGEVAGIGISNQRETTVAWDARTGEPLCDAVVWQCARASEICARIKA
KEGASEMVRARSGLPLSPYYPASKMAWILENVSSASEAARSGSLRMGTVDSWIIWVLTHG
TAFLCDHSNASRTQLFDIAALGWSQELCSLFGIDESCLPAVTDSDACFGYTDLEGFLPTP
IPIHAALGDSHAALFGQGCLKRGMAKATYGTGASVMLNVGARPIASAHGLSTSIGWRMGA
TETYVIEGNINYAGAVNTWLRDDLGLIDAPSEVEALCRSASRASRVYLVPAFSGLGAPHW
CDRAQAAILGMERSTHRAELVCAANESIAYQIADVVDAMREDAGIVLSELRVDGGPTANG
YLMQFQSDVLATPLRVAKNDEMSGMGAAWCAGVSLDIYGRDVAVDSAPRARFEPKMRPDE
RQSRIAGWRRALATTIGYARD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagcgccatggcgcgctatatcatcggcatcgatcagtccacgcagggaaccaag
gctctgttgctcgatgagcggggcactctgatacggcgcgtcgatcggccgcaccgccag
atcgtgagcgatagcggatggatcagccatgatcctcgcgagatcgcgcgcaacgtgatc
agatccagtcgggatgtcgtgctcgccgaggggattccgctcggggaggtagcaggcatc
ggcatctcaaaccaacgcgagaccacagtcgcatgggacgcccgtaccggagagccgctg
tgcgatgccgtggtgtggcaatgcgcgcgcgcgagcgagatctgcgcgcgcatcaaggcg
aaggaaggcgcatcggagatggtgcgcgcacgcagcgggctgcctctgtcgccgtattat
ccggcgtcgaagatggcatggatcttggagaacgtgagctcggcctcagaggccgctcgc
tccggaagcctgcggatgggaacggtagacagctggatcatctgggtgctcactcacgga
accgcgtttttgtgcgaccattccaacgcgagccgcacgcagcttttcgacatcgccgca
ctcggctggtcccaggagctgtgctcgctgttcggcatcgatgaatcgtgcctgcccgct
gtgaccgattccgacgcgtgcttcggatacaccgatctggagggctttctccctacgccg
attccgatccacgcagcgctgggtgacagccatgccgctctgttcggacagggttgcctg
aagcgcggcatggcaaaggcgacctacggtaccggtgcgtcggtcatgctcaatgtcggt
gcgcggccgattgcgagcgcgcacggactgtcgacgtcgatcggatggcggatgggcgcg
acggagacctatgtgatcgagggcaatatcaactacgcgggagctgttaacacctggctc
agggatgatctcgggctcatcgacgctccgagcgaggtcgaggcgctctgccggtctgca
tcccgggcgagtcgcgtctatctcgttcccgcattcagcggactcggtgcgcctcattgg
tgcgatcgggcgcaggccgcgatcttgggcatggagcgcagcacgcatcgggcggagctg
gtctgcgcggcaaatgagagcatcgcctaccagatcgcagatgtggtggacgccatgcgc
gaggacgctggaatcgtcctgtcggagctgcgcgtcgatggcggccccactgccaacgga
tatctcatgcagtttcaatccgacgtgctcgccacaccgctgcgggtcgcaaagaacgac
gagatgagcggcatgggtgccgcgtggtgcgctggagtctctctggacatctacggtcgc
gatgtcgcagtcgattccgcgcctcgagcccgattcgagccgaagatgcggccagatgag
cgccagagccgtatagcaggatggcgtcgagctctcgcgaccacgatcggttatgcccgc
gactga

DBGET integrated database retrieval system