KEGG   Coriobacterium glomerans: Corgl_1703Help
Entry
Corgl_1703        CDS       T01453                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cgo  Coriobacterium glomerans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Corgl_1703
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Corgl_1703
   00052 Galactose metabolism
    Corgl_1703
   00500 Starch and sucrose metabolism
    Corgl_1703
   00520 Amino sugar and nucleotide sugar metabolism
    Corgl_1703
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Corgl_1703
   00524 Butirosin and neomycin biosynthesis
    Corgl_1703
Enzymes [BR:cgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Corgl_1703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1995620..1996423)
Genome map
AA seq 267 aa AA seqDB search
MDVALGIDIGGTTVKSALVDRTGALIQKRSVRTESSAGHVKMAHDIAAMAKDMSKDLPDR
CTVVGAGAGAPGPVEGRMLLGAVNLGWGETPLAQAIERSSGLPTVLLNDANAAALGERWA
ARSHGGDLAENLLFATLGTGVGGAIIVNGSLLNGAHACGGEIGHIPSGKSEKRVCGCGNL
DCLETYASANGLLATANNLFVTNQVSAVPTCEELFERVKAGDRLATKALDDTIDLLARAL
AGIINTIDPEMVIIGGGLSAAGGTPIR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggatgttgcacttggtatcgacataggaggcacgacggtaaagagcgccttggtcgat
cggaccggcgcgcttattcaaaagagatctgtacgcacagagtcgagcgcgggacacgtc
aaaatggctcacgatatcgctgcgatggcgaaggatatgagcaaggatctaccagatcga
tgcactgttgtcggcgcaggcgccggcgcccccggtcccgtcgaagggcgcatgctgctc
ggtgcggtgaatctgggatggggagagaccccgcttgctcaagcgatcgagaggagttcg
ggccttccgaccgtgctgttgaacgatgcgaatgccgcagccttgggagagcggtgggcg
gcgagatcccatggtggcgatctggctgaaaacttgttgttcgcaaccctcggcacggga
gtggggggcgctatcatcgtgaacggatcgctcctgaacggagcccatgcgtgcggcggg
gagataggccacatcccctcgggaaaaagcgagaagcgcgtttgcggctgtgggaatctg
gattgcttggagacctatgcatcggccaacggattgcttgcaacagcaaacaatctgttc
gtaacaaatcaggtatctgcagtgcccacatgtgaggagctgttcgagagagtcaaagcg
ggcgatcgcctcgctaccaaagcgctcgatgacaccatcgatctgctcgctcgtgcgctg
gcaggcatcatcaacacgatcgatcccgagatggtgatcatcggaggaggactttcggct
gcggggggcacccctattcgatag

DBGET integrated database retrieval system