KEGG   Candida glabrata: CAGL0A01177gHelp
Entry
CAGL0A01177g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cgr  Candida glabrata
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CAGL0A01177g
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CAGL0A01177g
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CAGL0A01177g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:117020..119572
Genome map
AA seq 850 aa AA seqDB search
MKVSDGSKEVVCRERKLSSESRTSSESFSFLRRSNSSRSLLDDILSSSSSTSVKKNLKSV
KKMAPFLNYKDLGESIGAITYPYSMAPWVPNLLEVDNSGIKLDSDLERVMGVMREGVVLK
KVTRKKQREYMFKLEKNKYITWKDGLKKLNLDSIKSIRPGELGSNYREEYNVDASYSKYW
VTIIYKVSNKLKALHVIARDESDYNVFCSLVFGLVRTRRELMESLAVPDHDKFADIHWNR
ALSRNPDEKAEEVLGFEDVRQMCQRFHIYCSAGYLRRFFDAADTNNSGTLSFEEFQVFVK
LLKARKEIDDVWQEAVGLHEDKLTFDTFYKFLTEIQRERMDEDEARHLYERYETAGGGIN
KQGFEKYLTTSPYMLPNNEDYSRPMNQYYIASSHNTYLTGKQIGGAPSVEGYIQALQQGC
RSVEIDMWDGESSPVVCHGVLTSALPLSSVTQIIRKYAFITSPYPLIISMEVRCNSKNQR
IAASIFKDTFGDLLYTCEDRSELPSPLELRHRILLKIKKTKTVIGDCHSDKSMNVVVSSS
SSSRSSYDESTAMTKTGSRIRRLSFSKRQVAIVDELYELAGLRGVKFRNFSLPESKTLYH
CFSLDERRLDKMLGDAQVAAAVDKHNRRHMMRVYPHALRYRSTNFEDPVRFWRLGVQMVA
TNWQTNDVGHQLNVAMFQLNTRNQQQMPSGYVLKPGWLARPPSKRRRERCGAVLRVTFEV
ISAQLLPNLSESTETKSQAASIGAAETEDPYYTQVTCEMFSCGSTVEKSSKCHENGFSPV
WRSALSQDVRRDEYPFVFVRVVVRRCEEVVATTCVRVCQLREGYRHIPLCSPDGEQYVFS
TLFVRYRVTV
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgagtgatggttcaaaggaagtagtatgtcgggagagaaagttgtcgagtgaa
tctcgaaccagtagtgagtccttttcgtttttacggcggagcaattcctcgagatctttg
ctggatgatatcttgagttcatcaagtagcacaagtgtgaaaaagaatctaaagtctgtg
aagaagatggctccatttctgaactataaggacctaggagaaagtataggtgcgataact
tacccgtactcgatggctccttgggttcctaaccttttagaagttgataactctggaatc
aagctcgattcagatctggagagagtcatgggagtgatgagggaaggtgtggttttgaag
aaagtgaccaggaaaaaacaaagagagtacatgtttaaactagagaagaataagtatatt
acgtggaaagatggtctcaagaaacttaacctagactcaatcaagagcatacggcccggt
gaactcggaagcaactacagggaagagtataatgtcgatgcaagttacagcaagtactgg
gtaaccatcatttacaaagtgtccaacaagttgaaggcgctccatgtcattgctagggat
gagagcgactataacgtattctgttcgttggtttttgggctagtgaggaccaggagagag
ttgatggagagtctggcggttccggaccacgacaagtttgccgacatacattggaaccgg
gcgttatcacgcaatcctgatgagaaagctgaggaggtgctgggatttgaagatgtacgg
caaatgtgccagcggttccacatatactgctctgcgggataccttaggcgattcttcgat
gctgcagataccaacaatagtgggacactgagttttgaagaattccaagtgtttgtaaaa
ttattgaaagcacgcaaagagatcgatgatgtatggcaagaagcggttggtttacacgaa
gacaagctgacttttgatactttctacaagtttctaaccgagatccaacgagagaggatg
gatgaagatgaggcacgacacctgtacgagcggtatgagactgctggtggaggcatcaac
aagcaagggtttgagaagtacctcactacctccccgtacatgctacccaacaatgaggac
tacagtaggcctatgaaccagtattacatagcgtcctcgcataacacatatctcactggc
aagcaaataggtggggcaccatcagtagaggggtatatacaggcattacagcaagggtgt
cgcagtgttgagattgatatgtgggacggcgagagcagtcccgttgtgtgccatggggtg
ctaacctctgcgttgccgctgagttccgtgacgcagatcattcgcaagtacgcgttcatc
acctcgccttacccgctgataatctccatggaagtgcgatgcaacagcaagaaccagagg
atcgcagcgagtatattcaaggacacatttggggatttgctatatacgtgcgaggaccgc
agcgagctgccctcgcccttggagctgcggcaccgcatactgttgaagatcaagaagacc
aagactgtcattggcgactgccacagcgacaagtctatgaatgtagtggtgtcgtcgtcg
tcgtcttcgcggtcatcctatgacgagagcactgctatgacaaagacgggctcgcggatt
cggcggctgagcttcagcaagcggcaggtagcgattgtggacgagctgtacgagctagcg
ggcctccggggcgtgaagttccggaacttctccctgccggagtccaagacgctataccac
tgcttctcgctggacgagcggcggctcgacaagatgctcggggacgcgcaggtagccgcg
gcagtggacaagcacaaccgccggcacatgatgcgggtgtacccgcacgcgctgcggtac
cgctcgaccaacttcgaggaccccgtgcggttctggcggctgggcgtgcagatggtggcc
acgaactggcagacgaacgacgtgggccaccagctcaacgtggcgatgttccagctgaac
acgcggaaccagcagcagatgccctctggctacgtgctgaaaccgggctggcttgcgcgc
ccgccgagcaagcggaggcgcgagcgttgtggtgcggtgctgcgcgtcacattcgaagtg
atcagcgcacagttgctccccaacctgtctgagagcacggagacgaagagccaggcggct
agtatcggtgccgccgagacggaggacccgtactacacgcaggtcacatgcgagatgttc
agctgtggcagcacagtggagaagagcagcaagtgccacgagaacgggttcagtcccgtg
tggcggagtgcgctgtcgcaggacgtgcggcgggatgagtacccgttcgtgtttgtgcgc
gttgttgtgaggcggtgcgaagaggttgttgccacgacgtgtgtgcgcgtgtgccagctg
cgcgagggctacagacacatcccgctgtgcagccccgacggcgagcagtacgtgttttcc
acgcttttcgtgcgctaccgcgtcaccgtgtaa

DBGET integrated database retrieval system