KEGG   Candida glabrata: CAGL0A01430gHelp
Entry
CAGL0A01430g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cgr  Candida glabrata
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CAGL0A01430g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAGL0A01430g
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CAGL0A01430g
Enzymes [BR:cgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CAGL0A01430g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:147313..149436
Genome map
AA seq 707 aa AA seqDB search
MSHQLKQTFANAKNEGRNALVTFMTAGYPRVAETIPIMKGFQEGGVDVIELGMPFSDPIA
DGPTIQVANTKALENGVTLVQTLDLLKKARDEGVTVPVILMGYYNPILNYGEEKFIQDAA
DAGANGFIIVDLPPEEAIKVRNMMKKHGLSLVPLVAPSTTDSRLELLAKIADSFVYVVSR
MGTTGVQSSVASDLDTLVSRVRKYTKETPIAVGFGVSTREHFESVGSLSDGVVIGSKIVT
LCGEAPEGKCGEVAKKYVEEILNGKKHKILSGEEYQLMKTATNELESDSDHHEFEEDHKH
PIRFGDFGGQYVPEALHTCLKELEEGFEDAIADPTFWEEFKSLYSYIGRPSSLHKAERLT
EHCGGAQIWLKREDLNHTGSHKINNALAQVLIARRLGKTEIIAETGAGQHGVATATACAK
FGLKCTVFMGAEDVRRQALNVFRMRILGAKVVSVTNGTKTLRDATSEAFRFWVTNLKSTH
YVVGSAIGPHPYPTLVRTFQSVIGNETKEQFAALNNGKLPDVVVACVGGGSNSTGMFSPF
EHDTSVKLLGVEAGGDGIDTDYHSATLTAGRPGVFHGVKTYVLQDQDGQVHDTHSVSAGL
DYPGVGPELAFWKATGRAEFIAATDAQALEGFKLISQLEGIIPALESSHAVYGACERAKT
MKPDEHLIINISGRGDKDVQSVAEVLPKLGPQIGWDLRFEEDPSVGN
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatcaacttaagcaaacatttgccaatgcgaaaaatgaggggcgtaatgccttg
gtaacattcatgactgctggttatcctagagtcgcagagaccattccaataatgaagggt
ttccaagaaggtggtgttgatgtcattgaattgggtatgccattctctgatcctattgca
gatggtccaacaattcaagttgccaacaccaaggctttggagaacggtgtcactttggta
caaactttggacttgttaaagaaagctagagatgaaggtgttactgtccctgttatcctt
atgggttactacaatcctattctaaactatggtgaggaaaaattcattcaagatgcagcg
gatgcaggtgcaaacggtttcattattgttgatttgccacctgaagaagccattaaagtc
agaaacatgatgaagaagcacggattaagtttggttcctctagtggctccttctaccaca
gattctcgtcttgagcttttggctaaaatcgccgattcgttcgtctatgtcgtgtcaaga
atgggtactactggtgtccaatcatcggttgccagtgacctagatactctggtcagcaga
gttaggaaatacaccaaggaaacccctattgcagtaggttttggtgtctctactagagaa
catttcgaatctgttggaagtctatccgacggtgttgtcattggttccaaaatcgttact
ttatgtggggaagccccagaaggtaagtgtggtgaggtcgcaaagaagtacgtcgaagag
atactaaatggtaagaaacacaagattctatctggtgaagagtaccaactaatgaaaacg
gccaccaatgaactagaatccgattcggaccaccacgaatttgaagaagaccacaaacac
ccaataagatttggtgacttcggtggccaatacgttccagaagctttacatacatgtttg
aaggaactagaagaaggttttgaagatgcaattgctgatcctactttctgggaggaattc
aaatccttgtactcttacattggtcgtccatcttctttgcataaggctgaaagattgact
gaacactgtggtggtgcccaaatctggttgaagagagaagacttgaatcacactggttca
cataagattaacaacgctcttgcccaagttttaattgcaagaagattgggtaagacagaa
atcatcgccgaaactggtgctggtcaacacggtgtcgctactgcaacagcatgtgccaag
tttggtttaaaatgtactgtttttatgggagctgaagatgttcgtcgtcaagctctgaat
gttttcagaatgagaattctaggagctaaggttgtttccgttactaatggtacaaagact
ttaagagatgctacttctgaagctttcagattctgggtcacaaatttgaagagtacccac
tacgttgtgggttctgctattggtccacatccttacccaacactggtacgtactttccaa
agtgtgataggtaatgaaaccaaagaacaatttgctgctctaaataatggtaagcttcca
gatgtagtggtggcatgtgttggtggtggttcaaactcaactggtatgttttctccattc
gaacatgacacgagcgtcaaacttctgggtgttgaagcaggtggtgatggtatcgatact
gactatcatagtgctactttaaccgcaggtagaccaggtgtcttccacggtgtcaagaca
tacgttctgcaggatcaagatggtcaagtccatgatacacattccgtttcagcagggttg
gactatcctggtgttggtcctgaactggcattctggaaggcaacgggacgtgccgaattc
attgctgctactgatgctcaagctctagaaggtttcaagttgatctcccaacttgaaggt
attattccagctttagaatcatcacacgctgtttacggtgcatgtgaaagagcgaagacc
atgaaaccagatgaacacttgatcatcaacatttctggtagaggtgacaaggacgtccaa
agtgtcgctgaagttcttccaaaactcggtcctcaaatcggctgggacctgagattcgaa
gaagacccttctgtaggaaattag

DBGET integrated database retrieval system