KEGG   Candida glabrata: CAGL0A01430gHelp
Entry
CAGL0A01430g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cgr  Candida glabrata
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CAGL0A01430g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAGL0A01430g
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CAGL0A01430g
Enzymes [BR:cgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CAGL0A01430g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:147313..149436
Genome map
AA seq 707 aa AA seqDB search
MSHQLKQTFANAKNEGRNALVTFMTAGYPRVAETIPIMKGFQEGGVDVIELGMPFSDPIA
DGPTIQVANTKALENGVTLVQTLDLLKKARDEGVTVPVILMGYYNPILNYGEEKFIQDAA
DAGANGFIIVDLPPEEAIKVRNMMKKHGLSLVPLVAPSTTDSRLELLAKIADSFVYVVSR
MGTTGVQSSVASDLDTLVSRVRKYTKETPIAVGFGVSTREHFESVGSLSDGVVIGSKIVT
LCGEAPEGKCGEVAKKYVEEILNGKKHKILSGEEYQLMKTATNELESDSDHHEFEEDHKH
PIRFGDFGGQYVPEALHTCLKELEEGFEDAIADPTFWEEFKSLYSYIGRPSSLHKAERLT
EHCGGAQIWLKREDLNHTGSHKINNALAQVLIARRLGKTEIIAETGAGQHGVATATACAK
FGLKCTVFMGAEDVRRQALNVFRMRILGAKVVSVTNGTKTLRDATSEAFRFWVTNLKSTH
YVVGSAIGPHPYPTLVRTFQSVIGNETKEQFAALNNGKLPDVVVACVGGGSNSTGMFSPF
EHDTSVKLLGVEAGGDGIDTDYHSATLTAGRPGVFHGVKTYVLQDQDGQVHDTHSVSAGL
DYPGVGPELAFWKATGRAEFIAATDAQALEGFKLISQLEGIIPALESSHAVYGACERAKT
MKPDEHLIINISGRGDKDVQSVAEVLPKLGPQIGWDLRFEEDPSVGN
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatcaacttaagcaaacatttgccaatgcgaaaaatgaggggcgtaatgccttg
gtaacattcatgactgctggttatcctagagtcgcagagaccattccaataatgaagggt
ttccaagaaggtggtgttgatgtcattgaattgggtatgccattctctgatcctattgca
gatggtccaacaattcaagttgccaacaccaaggctttggagaacggtgtcactttggta
caaactttggacttgttaaagaaagctagagatgaaggtgttactgtccctgttatcctt
atgggttactacaatcctattctaaactatggtgaggaaaaattcattcaagatgcagcg
gatgcaggtgcaaacggtttcattattgttgatttgccacctgaagaagccattaaagtc
agaaacatgatgaagaagcacggattaagtttggttcctctagtggctccttctaccaca
gattctcgtcttgagcttttggctaaaatcgccgattcgttcgtctatgtcgtgtcaaga
atgggtactactggtgtccaatcatcggttgccagtgacctagatactctggtcagcaga
gttaggaaatacaccaaggaaacccctattgcagtaggttttggtgtctctactagagaa
catttcgaatctgttggaagtctatccgacggtgttgtcattggttccaaaatcgttact
ttatgtggggaagccccagaaggtaagtgtggtgaggtcgcaaagaagtacgtcgaagag
atactaaatggtaagaaacacaagattctatctggtgaagagtaccaactaatgaaaacg
gccaccaatgaactagaatccgattcggaccaccacgaatttgaagaagaccacaaacac
ccaataagatttggtgacttcggtggccaatacgttccagaagctttacatacatgtttg
aaggaactagaagaaggttttgaagatgcaattgctgatcctactttctgggaggaattc
aaatccttgtactcttacattggtcgtccatcttctttgcataaggctgaaagattgact
gaacactgtggtggtgcccaaatctggttgaagagagaagacttgaatcacactggttca
cataagattaacaacgctcttgcccaagttttaattgcaagaagattgggtaagacagaa
atcatcgccgaaactggtgctggtcaacacggtgtcgctactgcaacagcatgtgccaag
tttggtttaaaatgtactgtttttatgggagctgaagatgttcgtcgtcaagctctgaat
gttttcagaatgagaattctaggagctaaggttgtttccgttactaatggtacaaagact
ttaagagatgctacttctgaagctttcagattctgggtcacaaatttgaagagtacccac
tacgttgtgggttctgctattggtccacatccttacccaacactggtacgtactttccaa
agtgtgataggtaatgaaaccaaagaacaatttgctgctctaaataatggtaagcttcca
gatgtagtggtggcatgtgttggtggtggttcaaactcaactggtatgttttctccattc
gaacatgacacgagcgtcaaacttctgggtgttgaagcaggtggtgatggtatcgatact
gactatcatagtgctactttaaccgcaggtagaccaggtgtcttccacggtgtcaagaca
tacgttctgcaggatcaagatggtcaagtccatgatacacattccgtttcagcagggttg
gactatcctggtgttggtcctgaactggcattctggaaggcaacgggacgtgccgaattc
attgctgctactgatgctcaagctctagaaggtttcaagttgatctcccaacttgaaggt
attattccagctttagaatcatcacacgctgtttacggtgcatgtgaaagagcgaagacc
atgaaaccagatgaacacttgatcatcaacatttctggtagaggtgacaaggacgtccaa
agtgtcgctgaagttcttccaaaactcggtcctcaaatcggctgggacctgagattcgaa
gaagacccttctgtaggaaattag

DBGET integrated database retrieval system