KEGG   Candida glabrata: CAGL0A01716gHelp
Entry
CAGL0A01716g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
cgr  Candida glabrata
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cgr00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:169567..170202
Genome map
AA seq 211 aa AA seqDB search
MKTLLVIDVQNDFITPDHSMYVPQGEEVVSPIVELMKDPQWHRVVVSRDWHPQNHISFAK
NHGVEDYTETTYKSPRPGDDSTQPATLWPVHCVQNTRGAQLAPDILELVNSKHIKIVDKG
YLSNCEYYSAFNDTWEWHKTELDEYLKKHHTTEVYVVGLALDFCVKNTAISAAKLGYDTT
ILKDYTKPIYTDEDHQQQLEKDLKEHNVKVK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgctactagttatcgatgtgcagaacgacttcatcacgccggaccactccatg
tacgtgccccaaggcgaagaagttgtttcccccattgtcgagctcatgaaggacccccaa
tggcaccgtgtggtggtctccagggactggcacccgcagaaccacatctccttcgcgaag
aaccatggtgtcgaggactacaccgagaccacgtacaagtccccacgcccaggcgacgac
tcgacacagccggcaactctatggccagtgcactgtgtccagaacaccagaggtgcccaa
ctggcacctgacatcctcgagctggtcaactcgaagcacatcaagatcgtcgacaaaggg
tacttgtccaattgcgagtactacagtgcgttcaacgacacctgggagtggcacaagact
gagctcgacgagtacttgaagaaacaccacaccacagaggtctacgtcgtgggtctcgcc
ctcgacttttgcgtcaagaacacagccatcagcgcggcaaagctgggctacgacaccacc
atcctgaaggactacactaagcccatctacacagacgaggaccaccagcaacagctcgag
aaagacctcaaggaacacaacgtcaaggtcaaatag

DBGET integrated database retrieval system