KEGG   Candida glabrata: CAGL0A01716gHelp
Entry
CAGL0A01716g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K01440  nicotinamidase [EC:3.5.1.19]
Organism
cgr  Candida glabrata
Pathway
cgr00760  Nicotinate and nicotinamide metabolism
cgr01100  Metabolic pathways
cgr04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CAGL0A01716g
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    CAGL0A01716g
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CAGL0A01716g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 2886357
NCBI-ProteinID: XP_444840
UniProt: Q6FY20
Position
A:169567..170202
Genome map
AA seq 211 aa AA seqDB search
MKTLLVIDVQNDFITPDHSMYVPQGEEVVSPIVELMKDPQWHRVVVSRDWHPQNHISFAK
NHGVEDYTETTYKSPRPGDDSTQPATLWPVHCVQNTRGAQLAPDILELVNSKHIKIVDKG
YLSNCEYYSAFNDTWEWHKTELDEYLKKHHTTEVYVVGLALDFCVKNTAISAAKLGYDTT
ILKDYTKPIYTDEDHQQQLEKDLKEHNVKVK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgctactagttatcgatgtgcagaacgacttcatcacgccggaccactccatg
tacgtgccccaaggcgaagaagttgtttcccccattgtcgagctcatgaaggacccccaa
tggcaccgtgtggtggtctccagggactggcacccgcagaaccacatctccttcgcgaag
aaccatggtgtcgaggactacaccgagaccacgtacaagtccccacgcccaggcgacgac
tcgacacagccggcaactctatggccagtgcactgtgtccagaacaccagaggtgcccaa
ctggcacctgacatcctcgagctggtcaactcgaagcacatcaagatcgtcgacaaaggg
tacttgtccaattgcgagtactacagtgcgttcaacgacacctgggagtggcacaagact
gagctcgacgagtacttgaagaaacaccacaccacagaggtctacgtcgtgggtctcgcc
ctcgacttttgcgtcaagaacacagccatcagcgcggcaaagctgggctacgacaccacc
atcctgaaggactacactaagcccatctacacagacgaggaccaccagcaacagctcgag
aaagacctcaaggaacacaacgtcaaggtcaaatag

DBGET integrated database retrieval system