KEGG   Candida glabrata: CAGL0A03718gHelp
Entry
CAGL0A03718g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
cgr  Candida glabrata
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CAGL0A03718g
Exosome [BR:cgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   CAGL0A03718g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(378874..383832)
Genome map
AA seq 1652 aa AA seqDB search
MSDLPIEFTELTDLTALGISPQSLDFRSTTFESDHYVTVRETVDGANSVAIVDLANGNQV
TRKNMGGDSAIMHPSQNVISVRANGTIVQIFNLETKSKLKSFTLDEPVIFWKWLTENTLG
FVTARSILTCNVFDGNVSAKPQVLTQRHQSLNNTQIINFISNEKEDWFAVIGILQENGRI
AGKIQLYSKQRNISQAVDGHVAIFTKILLEGNGSAPVQVFVTGNRNVQTGNGELRIIEID
HDASLAVQYQKKTTDIFFPPDATNDFPLSVQVSEKYGIIYILTKYGFIHLYELETGTNLF
VNRITAESVFTSTSYNQKNGIACINKKGQVLAVEIDTTQIVPYILNKLANVSLALTVATR
GGLPGADDLFSKQFESLLNQGDYQNAAKVAASSTSLRNQNTINRLKNLQAAPGAISPILL
YFSTLLDKGKLNKEETIELARPVLQQDRKQLFEKWLKEDKLECSEELGDIVKPFDTTLAL
ACYLRANAHAKVISCLAELQQFEKIIPYCQKVSYQPNFLVLLSQLIRTSPDRASEFAISL
LQNPETASQVDIEKLADLFFSQNHIQQGTSLLLDALKGDTPDQGHLQTRVLEVNLMNAPQ
VADAILGNNIFSHYDKPTIASLAEKAGLYQRALENYTDLKDTKRCIVHTSSLPVDWLISY
FGKLNVEQSLACLRALMDDNLQGNIQIVIQVATKYSDLIGSSTLIKLFEEYRATEGLYYY
LASLVNLTEDKDVVYKYIEAAAKMKQYKEIERIVRDNNVYDAERVKNFLKEANLEDQLPL
IIVCDRHNFVHELILYLYKAQNMNYIETYVTQVNPSKTPQVVGALLDMDCDEKFIQNLLQ
SVIGQVPINDLTEEVEKRNRLKLLLPYLEQTLSQGTQEQAVYNALAKIYIDSNNAPEKFL
KENDQYDTLDVGRYCEKRDPYLAYIAYDKGSNDDDLIRITNENTMYKYQARYLLKRSDPE
LWNKVLDSENIHRRQLIDSVISVGIPELKDPEPVSLTVQAFMTNGLKLELIELLEKIILE
PSPFNENTALQGLLMLSAIKYEPTKVSGYIEKLENYDADEIAQLCVEHGLNEEAFEIYDK
HEMNSKALKVLIEDIMSLDRGYTYADKINSSELWSQLGTAQLDGLRIPDAIDSYIKANDP
SNYENVIDLAEQAEKFEELIPYLLMARDTLKASKIDNALVLSYAQLNKLHEIENLLAGSN
SANLEEVGDKLLDSKNYKAAKLCYSSVSNYSKLASTLVYLGDYQTAVDTARKASNIKVWK
LVNNACIDKKEFRLAQICGLNLIIHAEELDELVEKYESNGYFEELISLFEAGLGLERAHM
GMFTELAILYAKYDTSKTYDHIKLFWSRINIPKVIKAAEDAHLWRELVFLYAHYDEWDNA
ALTMIEKSADNFDHPYFKEVIVKVANLEIYYKAINFYVNEHPSLLVDLLSVLTPRLDIPR
TVKIFSQSDNLPLIKPFLINVLQKNNSVVNKAYHDLMIEEEDHQALQNAVDSYDKFDQLE
LAGRLEKHDLIYFKKIAALLYRRNKKWSKALDILKEQRLWKEAIETAAISQDTKVVHDLL
SYFVDTGNREAFVALLYTAYNLIKYDFVLEVSWLNSLEDFIKPYEISVKKEQNAAVEKLS
EEFAKKNNTSDDREGQPLMLMNSSMHPQATGF
NT seq 4959 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttgccaattgagttcaccgagctcacggatctgaccgcgctgggtatctcc
ccgcagtcgctggacttcagatcaactacattcgaaagtgaccactacgtgaccgttagg
gagactgtcgatggcgcgaactccgtggccatcgtcgacttggcgaacgggaaccaggtc
accaggaagaacatgggcggtgactccgcgatcatgcacccttcccagaacgtgatctct
gtgcgtgccaacggcaccatcgtccagatcttcaacttggagaccaaatccaagctgaag
tccttcaccttggacgagccagtgatcttctggaagtggctcaccgagaacaccttgggt
ttcgtcaccgcgcgctccatactcacctgtaacgtcttcgacggcaacgtctctgcaaag
ccacaggtgttgacccagagacaccagtcattgaacaacacccagatcatcaacttcatc
tcaaacgagaaggaggactggttcgcagtcatcggtatcttgcaggaaaacggaagaatc
gccggtaagatccaactttactcgaaacaacgtaacatctcccaggcagtagacggccac
gtcgccatcttcaccaagatactgctagaaggtaacggctccgcaccagtacaagtcttc
gtcaccggtaacagaaacgtacaaacgggtaacggtgaattgagaatcattgagatagat
cacgatgcctccttggctgtacaataccaaaagaaaaccacagatatcttcttcccacca
gacgctacaaatgacttcccattgtccgtccaggtctccgagaaatacggtatcatctac
atcctaacgaaatacgggttcattcacttatatgaactggagacaggcacaaacttgttc
gtcaacagaattaccgccgagtccgtcttcacttccacttcttacaaccaaaagaacggt
atcgcctgtataaacaagaaaggccaagtgctagcagtagagatcgacaccactcagata
gtgccatacatcctaaacaaattggctaacgtctccctagcgctaacagttgccactaga
ggtggccttccaggtgcagacgacctgttctctaagcaattcgagtccctcttgaaccaa
ggcgattaccaaaacgctgcaaaggtcgcagcatcctcaacttctctgagaaaccaaaat
accatcaatagattgaagaacttacaagcagcaccaggtgccatctcacctatattgctt
tacttctccactcttctagacaagggtaagttgaacaaagaagaaaccatcgagttggcc
agaccagtgctacaacaggacagaaagcaactatttgaaaaatggttgaaagaggacaaa
ttggagtgctcagaagaacttggtgacattgtcaaaccatttgataccaccttggctttg
gcttgttacttgagagccaatgctcatgcaaaggtcatctcttgcttagctgagctacaa
caatttgaaaagatcattccatattgtcaaaaggtaagctaccaaccaaactttttggta
ttgctttctcaactaattagaacttccccagacagagcttctgaatttgcaatctcccta
ttgcaaaacccagaaactgccagccaagttgacatcgaaaagttggctgacctattcttc
tctcaaaaccacatccagcaaggtacttccctattgttagatgctttgaaaggtgatact
ccagaccaaggtcacttgcaaactcgtgtcctggaagttaacttgatgaatgcccctcaa
gttgctgacgcaatcttgggcaataacatcttctctcactatgacaagccaacgattgct
tctttagcagaaaaagctggtctgtaccagagagctctggaaaactacaccgatcttaag
gataccaagagatgtattgtccacacaagcagcctaccagttgactggttgatcagttac
tttggtaagttgaacgtcgaacaatctttggcttgtttgagagccctaatggacgacaac
ttacaaggcaacattcaaatcgtcattcaagttgcaacaaagtactccgatctaatcgga
tccagtactctaattaagctattcgaggagtacagagctactgaaggtctgtattactac
ttggcttccttagttaacttaactgaagacaaggacgttgtttacaaatacatcgaggct
gctgctaagatgaaacaatacaaggagattgaaagaattgtcagagacaacaatgtttat
gatgctgaaagagttaagaatttcttgaaagaagctaacttggaagatcaactacctctg
attatcgtgtgtgatcgtcacaattttgttcatgagttgatcttgtatctatacaaggca
caaaacatgaactacattgaaacttacgttactcaagtcaacccaagcaaaaccccacaa
gttgttggtgctttgcttgacatggattgcgacgaaaagttcattcaaaacttgttgcaa
tctgttattggccaagttccaatcaacgatttgactgaagaagtcgaaaagagaaacaga
ttgaagcttctgttgccatacttggaacaaactttatctcaaggtacccaggaacaggct
gtttacaatgccttggctaagatctacattgactccaacaacgctccagagaagttcttg
aaggagaatgatcaatacgatactttggatgtcggtcgttactgtgagaagagagatcca
tacttagcttacattgcttacgacaagggttccaacgatgacgatttgattagaatcact
aacgagaacactatgtacaagtaccaggctagatacctactaaagcgttctgatcctgaa
ttgtggaacaaggtgttagattctgaaaacattcatagacgtcaactaattgactctgtc
atttctgttggtatcccagaactaaaggacccagaaccagtgtctttgaccgtccaagct
tttatgaccaacggattgaaattggaattgatcgagttgcttgaaaaaattatattggaa
ccatctccatttaatgaaaatactgctttgcaaggtctgttgatgctatcagccatcaag
tacgagccaaccaaagtttctggatatatcgaaaagctagaaaattatgacgctgatgag
atcgcacagttatgtgttgaacatggtttgaatgaagaagccttcgaaatctatgacaag
catgagatgaactctaaagcactaaaggttttgattgaagatatcatgtctttggacaga
ggctacacatatgctgacaagattaactcttcagaactatggtctcaattgggtactgcg
caattggatggtcttcgtattcctgatgctattgattcctacatcaaagcaaatgaccca
tctaactatgagaatgttatcgatttagcagaacaagctgaaaagttcgaagaattgatt
ccatacttgttgatggcaagagatactttgaaggcttcaaagattgataatgctttggtt
ctgtcttatgctcaattgaataagcttcatgaaattgagaacttgctggctggttcaaac
tccgccaacttggaagaagtcggtgataaattgcttgacagcaagaactacaaggcagct
aaattgtgttactctagtgtttctaactactccaaattggcctcaactttggtttacttg
ggtgactaccaaactgctgtagacactgctagaaaggcatccaacatcaaggtctggaaa
ttagtgaacaacgcatgtattgacaagaaggaattcagacttgcccaaatttgtggtcta
aacttaataattcacgctgaagagcttgacgagcttgtcgaaaagtatgagtcgaatggt
tactttgaagaattaatttctttattcgaagcaggtctaggtttggaaagagcccatatg
ggtatgttcacagagctagctattttgtatgccaagtacgatacttcaaagacctatgat
cacattaaattattctggtcaagaattaacattccaaaggttatcaaggctgctgaagac
gctcacctatggagagaattggttttcttgtatgctcattatgatgaatgggacaatgct
gctttgactatgatcgaaaaatctgctgataactttgatcatccttacttcaaggaagtt
attgttaaggttgcaaatcttgaaatttactacaaagcaattaacttttacgtcaacgag
cacccatctctattagtcgatctattgtccgttttaactccaaggcttgatattccaagg
actgttaagattttctcacaatcagataacttacctttaatcaagccattcttgatcaat
gttctacaaaagaacaactctgtggttaataaggcttatcatgatttgatgatcgaagaa
gaagatcatcaagccttgcaaaatgctgtcgactcctatgacaagttcgatcaattagaa
cttgctggcagattggaaaaacacgacttgatatacttcaagaagattgctgcgctattg
taccgtagaaataagaagtggtcaaaggcattagatatcctaaaggaacaaagactatgg
aaggaggccattgagactgctgctatttcccaggatactaaggtcgtccatgatttattg
tcctactttgtcgatacaggtaatcgtgaagcatttgttgcattgttgtacactgcctac
aatttgataaagtatgattttgttttggaagtttcctggttgaattctctagaagatttc
attaagccatacgagatctctgtgaagaaagaacaaaatgcagctgttgaaaagctttcg
gaggaatttgctaagaagaacaacacatcggatgatagggaaggtcagccactaatgttg
atgaactcttcaatgcaccctcaagcaactggcttctaa

DBGET integrated database retrieval system