KEGG   Candida glabrata: CAGL0A04125gHelp
Entry
CAGL0A04125g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cgr  Candida glabrata
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CAGL0A04125g
Translation factors [BR:cgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CAGL0A04125g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:410626..411423
Genome map
AA seq 265 aa AA seqDB search
MSWDDAGNDDAVLMDSWDAEVDFAGDEPILDSWDEEPKAKKEAAKPKPKPKAGGKKNAKG
EEKKEQVLAIDELDPQTRKELMKKAELESDLNNAADLLGDLEMAEEHPRARAMQKEQELA
AQAALLRPAMTKDTPIEDHPLFKAETKKEYQDLRKALATAIVTMHEKSSLNYSSSLAIDL
IRDVSKPMSIENIRQTVATLNILIKDKEKAERQARLARVKGGTATGGAGKKKAKAKTNLG
GAFKKDQDFDVDDINYDDFGADDFM
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggatgatgctggaaacgacgatgctgtcctgatggactcctgggatgccgag
gttgattttgccggcgatgagcctattctggactcatgggatgaggagccaaaggccaag
aaggaggctgccaagcctaagcctaagccaaaggctggtggtaagaagaatgccaagggt
gaggagaagaaagagcaagtgctggccattgatgagctagatcctcagacgcggaaggag
ctgatgaagaaggccgagctagagtccgacttgaacaacgctgctgatcttcttggagac
ttggagatggccgaggagcacccaagagctcgtgctatgcagaaggagcaagaattggca
gcacaagccgcacttttgagacctgcgatgactaaagacacaccaattgaagaccaccca
ttattcaaggcagagaccaagaaggaataccaggacctaagaaaggcattggctactgcc
attgtcactatgcatgaaaaatcttctctaaactactcatcctccttggccattgatttg
atcagagacgtatcgaagccaatgtccatcgaaaatattagacagactgtcgccacccta
aatatcctaatcaaggacaaggagaaggctgaaagacaggctcgtttggctcgtgtcaag
ggtggtaccgctactggtggtgctggtaagaagaaggctaaggccaagaccaatttgggt
ggtgctttcaagaaagatcaagatttcgacgtggatgacatcaactatgatgacttcggt
gctgacgattttatgtaa

DBGET integrated database retrieval system