KEGG   Candida glabrata: CAGL0B00704gHelp
Entry
CAGL0B00704g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cgr  Candida glabrata
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CAGL0B00704g
Enzymes [BR:cgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CAGL0B00704g
Exosome [BR:cgr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CAGL0B00704g
  Exosomal proteins of colorectal cancer cells
   CAGL0B00704g
  Exosomal proteins of bladder cancer cells
   CAGL0B00704g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(60373..61944)
Genome map
AA seq 523 aa AA seqDB search
MLFNKGLLALAATAALGVSAQDAVAPADSAVVKLEQDNFQDFLKENSLVMAEFFAPWCGH
CKKLAPEYVKAAEELKSKNVSLVQIDCDDNRDLCMQLQIPGFPSIKLIKDGDIAHAKDYN
GARTAEAIVKFMIKQTQPAVQVVEDKAALDALVANSTVPVVVDFGVNDFNATFYQFAHAL
SDDYVFISLPSKENKISVFLPVEGSSAEEIVFKGDHKTLAKDRSVFEEWLKVESLPFFGE
INGEVFNAYLESGLPLAYFFFNEPSEVEENRKFFTDLAKKYRGKMAFVSLDAKQFGRHAE
NLNMKQQFPLFAIHNMTSNQKFGLPQMAEEEFAKLNKAIKLKTKDITKLVENVLSGKAEA
IVKSEEVPSVQESNVFKIVGKTHDKIVADPKKDVLVKYYAPWCGHCKKMAPTYEELADTY
ASDSSSKDKVVIAEVDATANDIFNVEIAGYPTILLYPAGKNAEPVVYEGDRSLDSFLTFI
KENGANGIDGSSLHKKFLETKKAAEQAEIEDDNEDEDGFDDEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctttttaacaagggtctattagccttggctgccactgcagctttgggtgtttctgca
caagacgctgttgcaccagctgattctgctgttgttaagctagaacaagacaacttccag
gacttcttgaaggagaactccttggttatggctgagttctttgccccatggtgtggtcat
tgtaagaagttagctccagagtacgtcaaggctgctgaggagcttaagagcaagaatgtc
tctctagtacaaatcgactgtgatgacaacagagacctatgtatgcaattgcaaattcca
ggtttcccatcaatcaagttgatcaaggacggtgacattgctcatgccaaggactacaac
ggtgctagaactgccgaggccattgtcaagttcatgatcaagcaaacacaaccagctgtt
caggtcgtcgaagacaaggctgctctagatgctttagtggctaactctacagttccagtg
gttgttgacttcggtgtcaacgacttcaacgctactttctaccaattcgcccacgctctt
tctgatgactacgtcttcatctctttgccatccaaggagaacaagatctctgtcttccta
cctgtcgaaggttcctctgctgaagaaattgtcttcaagggagaccacaagactttggct
aaggacagatctgttttcgaagagtggttgaaagttgaatctttgccattctttggtgaa
atcaacggtgaagttttcaatgcctacttagaaagtggtttgcctctagcttacttcttc
ttcaatgaaccatctgaagttgaagaaaatagaaaattcttcactgacttggccaagaag
taccgtggtaagatggcttttgtcagcctggatgccaagcaatttggtagacacgccgag
aacttgaacatgaagcaacaattcccattgttcgctatccacaacatgactagcaaccaa
aaattcggtctaccacaaatggccgaagaagagttcgctaagttgaacaaggctatcaag
ttaaagaccaaggacatcaccaaattggttgaaaatgtcttatctggtaaggctgaagct
attgtcaagtctgaagaagttccatcagtccaagaaagcaacgttttcaagatcgttggt
aagacccacgacaagattgttgctgatcctaagaaggatgttcttgttaagtactatgcc
ccatggtgtggtcactgtaagaagatggctccaacttatgaagaattggcagacacttac
gcctccgactcatcctctaaggacaaggttgttattgctgaggttgatgctactgccaat
gacattttcaatgtcgaaattgctggttacccaaccatattgttgtacccagctggtaag
aacgctgagcctgttgtttacgaaggtgacagatctttggactccttcttgactttcatt
aaagaaaacggtgccaacggtattgacggttcttctctacacaagaagttcctagagacc
aagaaggctgctgaacaggctgaaattgaagacgacaatgaagatgaggatggatttgat
gatgaattgtag

DBGET integrated database retrieval system