KEGG   Candida glabrata: CAGL0B00704gHelp
Entry
CAGL0B00704g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cgr  Candida glabrata
Pathway
cgr04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CAGL0B00704g
Enzymes [BR:cgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CAGL0B00704g
Chaperones and folding catalysts [BR:cgr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   CAGL0B00704g
Membrane trafficking [BR:cgr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    CAGL0B00704g
Exosome [BR:cgr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CAGL0B00704g
  Exosomal proteins of colorectal cancer cells
   CAGL0B00704g
  Exosomal proteins of bladder cancer cells
   CAGL0B00704g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_8 AhpC-TSA Thioredoxin_7 ERp29_N Thioredoxin_2 Redoxin DUF1480
Motif
Other DBs
NCBI-GeneID: 2886594
NCBI-ProteinID: XP_445001
UniProt: Q6FX95
Position
B:complement(60373..61944)
Genome map
AA seq 523 aa AA seqDB search
MLFNKGLLALAATAALGVSAQDAVAPADSAVVKLEQDNFQDFLKENSLVMAEFFAPWCGH
CKKLAPEYVKAAEELKSKNVSLVQIDCDDNRDLCMQLQIPGFPSIKLIKDGDIAHAKDYN
GARTAEAIVKFMIKQTQPAVQVVEDKAALDALVANSTVPVVVDFGVNDFNATFYQFAHAL
SDDYVFISLPSKENKISVFLPVEGSSAEEIVFKGDHKTLAKDRSVFEEWLKVESLPFFGE
INGEVFNAYLESGLPLAYFFFNEPSEVEENRKFFTDLAKKYRGKMAFVSLDAKQFGRHAE
NLNMKQQFPLFAIHNMTSNQKFGLPQMAEEEFAKLNKAIKLKTKDITKLVENVLSGKAEA
IVKSEEVPSVQESNVFKIVGKTHDKIVADPKKDVLVKYYAPWCGHCKKMAPTYEELADTY
ASDSSSKDKVVIAEVDATANDIFNVEIAGYPTILLYPAGKNAEPVVYEGDRSLDSFLTFI
KENGANGIDGSSLHKKFLETKKAAEQAEIEDDNEDEDGFDDEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctttttaacaagggtctattagccttggctgccactgcagctttgggtgtttctgca
caagacgctgttgcaccagctgattctgctgttgttaagctagaacaagacaacttccag
gacttcttgaaggagaactccttggttatggctgagttctttgccccatggtgtggtcat
tgtaagaagttagctccagagtacgtcaaggctgctgaggagcttaagagcaagaatgtc
tctctagtacaaatcgactgtgatgacaacagagacctatgtatgcaattgcaaattcca
ggtttcccatcaatcaagttgatcaaggacggtgacattgctcatgccaaggactacaac
ggtgctagaactgccgaggccattgtcaagttcatgatcaagcaaacacaaccagctgtt
caggtcgtcgaagacaaggctgctctagatgctttagtggctaactctacagttccagtg
gttgttgacttcggtgtcaacgacttcaacgctactttctaccaattcgcccacgctctt
tctgatgactacgtcttcatctctttgccatccaaggagaacaagatctctgtcttccta
cctgtcgaaggttcctctgctgaagaaattgtcttcaagggagaccacaagactttggct
aaggacagatctgttttcgaagagtggttgaaagttgaatctttgccattctttggtgaa
atcaacggtgaagttttcaatgcctacttagaaagtggtttgcctctagcttacttcttc
ttcaatgaaccatctgaagttgaagaaaatagaaaattcttcactgacttggccaagaag
taccgtggtaagatggcttttgtcagcctggatgccaagcaatttggtagacacgccgag
aacttgaacatgaagcaacaattcccattgttcgctatccacaacatgactagcaaccaa
aaattcggtctaccacaaatggccgaagaagagttcgctaagttgaacaaggctatcaag
ttaaagaccaaggacatcaccaaattggttgaaaatgtcttatctggtaaggctgaagct
attgtcaagtctgaagaagttccatcagtccaagaaagcaacgttttcaagatcgttggt
aagacccacgacaagattgttgctgatcctaagaaggatgttcttgttaagtactatgcc
ccatggtgtggtcactgtaagaagatggctccaacttatgaagaattggcagacacttac
gcctccgactcatcctctaaggacaaggttgttattgctgaggttgatgctactgccaat
gacattttcaatgtcgaaattgctggttacccaaccatattgttgtacccagctggtaag
aacgctgagcctgttgtttacgaaggtgacagatctttggactccttcttgactttcatt
aaagaaaacggtgccaacggtattgacggttcttctctacacaagaagttcctagagacc
aagaaggctgctgaacaggctgaaattgaagacgacaatgaagatgaggatggatttgat
gatgaattgtag

DBGET integrated database retrieval system