KEGG   Candida glabrata: CAGL0B00902gHelp
Entry
CAGL0B00902g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
cgr  Candida glabrata
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cgr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cgr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(78387..80795)
Genome map
AA seq 802 aa AA seqDB search
MVFPILPVFGKDLNLASRPYIKLVNQAVLDYTVSKEDIIKFVKDSQLLFVGTLLSSGKFK
DDEVIEILNNGVAVLFIEDHSYAGYLVTEVGIPQERISVLNENVYETHFVIVNKFNAKTQ
LVPVEEITSSTLSQTLIDSLKTDRADGLYTTLVVDSQERCLGLVYSSKESIQMAINEESG
IYYSRSRDEIWVKGATSGNTQKLLSISVDCDGDALKFVVDQQGKDRSFCHLNTESCFGGF
THGLASLEQLLRDRFESAPEGSYTKRLFNDPELLNAKIKEEAEELTEAEDKNEISWEAAD
LFYFALTKLVANNVSLKDVESNLNMKHLKITRRKGDAKDKFIKKQEPQAQNDEELSSKPI
HLNVVKTSNKKEVEAALTRPIQKTSEIMHLVNPIIEGVRSKGDKALIEFTAKFDGVQLQS
PVLEAPFPPEYFEGLTEEMKESLDLSIENVRKFHAAQLQTEDLEVETQPGVLCSRFPRPI
EKVGLYIPGGTAVLPSTALMLGVPAKVAGCKEIVFASPPRKSDGRVSPEVVYVAEKVGAS
KIVLAGGAQAVAAMAYGTESVPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSE
VLVIADNNADVDFVASDLLSQAEHGIDSQVILVGVELTDDKIQQIQDAVHRQALELPRVD
IVRKCIAHSSIIVCDSYQSAFDMSNRYAPEHLILQIENAKDYVKLVDHAGSVFVGAYTPE
SCGDYSSGTNHTLPTYGYARQYSGANTSTFQKFITAQSITPEGLDNIGRAVMCVAKVEGL
DGHRNAVKIRMSKLGLLPKDFN
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggttttccctatactgccagtgtttggtaaggatttgaatttggcctcgagaccatat
attaagctagtgaatcaagcagttttggattatactgtctccaaagaagacatcattaaa
tttgtaaaggactctcaattgctatttgtaggtaccctattgagctctggtaaatttaag
gatgacgaagtaattgagattctaaataatggggttgctgtcttgtttatcgaggaccat
tcatacgctggctacttggtcactgaagttggcatccctcaggagagaatctctgtgcta
aatgaaaacgtatacgagactcactttgttattgtcaataagttcaatgcaaagactcaa
ttggtcccagttgaagaaatcacctcctcaactctaagtcaaacactgatcgattccttg
aagactgatcgagctgatggcctctataccacgctagtagttgactctcaggaacgttgt
ctaggtctggtatactcttcaaaggagtccattcaaatggctattaacgaggaatcagga
atctactactcccgttccagagatgaaatttgggtgaaaggagccacctcaggaaatacc
caaaagctgctgtcgatctctgttgactgtgatggcgatgctttgaagtttgttgttgat
caacaaggtaaggatagaagtttttgtcacttgaataccgaatcatgttttggtggcttc
acccatggcttagctagtttagagcaattgcttagagatagatttgaaagtgccccagaa
ggctcctacaccaaaagattatttaatgatcccgaattattgaacgctaagattaaggaa
gaagctgaagaattgacagaagctgaggataagaacgaaatatcatgggaagctgcagac
ttgttctacttcgctctaactaaactcgtggcaaacaatgtcagtcttaaggatgtagaa
tccaatctgaacatgaagcacttgaaaatcaccagaagaaagggtgatgctaaagataaa
tttataaagaaacaagaaccgcaagctcaaaatgatgaagaattgtcttcaaaacctatt
cacttaaacgtagtcaaaacatcaaataagaaagaagtagaagctgctttgacaagacca
attcaaaaaacatccgaaattatgcacttggtcaaccctataattgaaggtgttaggagt
aaaggtgacaaagctttaattgaattcacagcaaaatttgatggtgtccaactacaatct
cccgttctagaagcaccatttccaccagaatatttcgagggtctaactgaagaaatgaag
gaatcactagacttgtcaattgaaaatgttcgcaaattccatgcggctcaattacaaact
gaagatctagaagttgaaactcaaccaggtgttctctgctctagattcccaagacctatt
gagaaagttggtctgtatattccaggtggtaccgcagtgttaccaagtacagcccttatg
ttgggtgtcccagctaaggttgctggatgtaaagaaattgtttttgcttcaccccctcgt
aagtcagatggcagagtttctccagaagttgtgtatgtggctgagaaagtcggagcttca
aagatcgtcttggctggtggtgctcaagctgttgcagctatggcctatggtactgaatct
gttccaaaagttgacaaaattcttggccctggtaaccagtttgttacagctgctaaaatg
tatgtgcaaaatgacacacaagctctgtgctcaatcgatatgccagctggcccaagtgaa
gttctagtgattgccgataacaacgctgatgttgactttgttgccagtgatttgctatca
caagctgagcatggtattgactcccaagttattcttgtcggtgttgagttaactgatgat
aagatccagcagatccaagatgctgtccacagacaagctttggaactacctcgtgtagac
attgttcgtaaatgtattgctcacagttctatcattgtttgtgatagttatcagtctgcc
tttgatatgtctaacagatacgctcctgagcacttgatattgcaaattgagaatgccaag
gattacgttaagctggttgatcacgctgggagtgtttttgtgggtgcttacacaccagag
tcgtgtggtgattattccagtggtacaaaccacactttaccaacatatgggtatgccaga
cagtatagcggagctaatacatctactttccagaaattcatcaccgcacagagcattaca
cctgaaggtctagacaatattggacgcgctgtgatgtgtgttgcaaaagtcgaaggtcta
gatggtcatagaaatgctgtgaagattagaatgtccaagttgggattgcttccaaaggac
ttcaactaa

DBGET integrated database retrieval system