KEGG   Candida glabrata: CAGL0B02717gHelp
Entry
CAGL0B02717g      CDS       T01024                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cgr  Candida glabrata
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cgr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cgr00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cgr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cgr00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:cgr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(258671..260722)
Genome map
AA seq 683 aa AA seqDB search
MTLKEHKTVHEAQNAVARQAPEHFYKSQPSRGGFIKDISEYERLYKQSIEDPETFFSEKA
RELLHWDAPFSKVSYGSLEQGDVAWFLNGKLNASYNCVDRHAFANPDKPAIIYEADDEKD
NYTITFGELLRRVSKVAGILKSWGVKKGDTVAIYLPMIPEAIIAMLAVVRLGAIHSVVFA
GFSAGSLKDRVVDAGSKVVITCDEGRRGGKTVHLKKIVDEGLNGVDQVSRILVFKRTGTE
GIPMKAGRDFWLHEEADKRRSYLPPVPCDAEDPLFLLYTSGSTGSPKGIVHTTGGYLLGA
AMTTKYVFDVHPEDVFFTAGDVGWITGHTYALYGPLLLGVPTICFESTPAYPDYGRYWRI
VERHKATHFYVAPTAMRLIKRVGEAEISKYDLSSLRVLGSVGEPISPELWEWYNEKIGNN
NCVVCDTFWQTESGSHLIAPMAGAIPTKPGSTTLPFFGIDACIIDPVSGVEIEGNDVEGV
LAVKSPWPSMARSVWNDHVRYVDTYMKPYPGYYFTGDGAGRDHDGYYWIRGRVDDVVNVS
GHRLSTAEIEACLVNHENISETAVVGINDELTGQAVIAFVSLKEGYLQNDAPEGDAEHIT
PSNLRRELILQVRGEIGPFASPKCIILVRDLPKTRSGKIMRRVLRKIASNEADQLGDLST
LANADVVPAIISACENQFFAEKK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgacattaaaagaacataagactgtgcatgaagcacagaacgctgttgctcgccaagct
ccagagcatttctacaagagccagccaagcagaggtggtttcataaaggacatctccgaa
tatgaaagactttacaagcagtcgattgaggacccagagactttcttcagtgaaaaggct
cgtgaactattgcactgggacgccccattctctaaagtatcgtacggttctctagagcaa
ggtgatgtcgcttggttcctaaacggtaaactaaacgcctcttacaactgtgtggacaga
cacgcctttgccaacccagacaagcctgccattatctatgaagcagacgacgagaaggac
aactataccatcacttttggtgaattgctgagaagagtatctaaggttgctggtatcttg
aagagctggggtgtcaagaaaggtgacactgttgccatttacttgccaatgatcccagaa
gctattattgctatgttggccgttgtgcgtcttggtgccatccactctgtcgtcttcgcc
ggtttctcagctggttctttgaaagaccgtgtagtcgatgctggttccaaggttgtcatc
acttgtgatgaaggccgtagaggtggtaagactgtccacttgaagaaaatcgttgatgaa
ggtttgaacggtgtcgatcaagtctctcgtattttggttttcaagagaacaggtactgaa
ggtattccaatgaaggctggtagagatttctggttgcacgaggaagctgacaagagaaga
tcatatctaccacctgttccatgtgatgccgaagatccactattcctactatatacatct
ggttctaccggctctccaaagggtatcgtgcacactactggtggttatttgctaggtgcc
gctatgactactaagtacgtcttcgatgttcatccagaggatgttttcttcactgctggt
gatgtcggctggattacaggtcacacctacgctctatacggtccattgttgctaggtgta
ccaactatctgcttcgaatctacaccagcttacccagattacggtagatactggagaatt
gtcgaacgtcacaaggccacccacttctacgttgcaccaactgctatgagattgattaag
cgtgttggtgaagctgaaattagcaagtacgacttgtcctccctacgtgtcctaggttct
gtcggtgaaccaatttctcctgaactatgggaatggtacaacgaaaagattggtaacaac
aattgtgttgtttgtgacactttctggcaaactgaatccggttctcatttgattgcccca
atggcgggtgccatcccaaccaaaccaggttctaccactcttccattcttcggtattgat
gcttgtatcattgatccagtttctggtgttgaaattgaaggaaacgatgtcgaaggtgtt
ttagctgttaaatcaccatggccatccatggctagatctgtctggaacgatcacgttcgt
tatgtcgacacttacatgaagccatacccaggttactactttacaggtgatggtgctggt
agagaccacgatggttactactggatcagaggtagagttgacgatgttgttaacgtctct
ggtcataggttatctactgcagaaattgaagcctgtttggttaaccatgagaatatctct
gagaccgctgtggttggtatcaatgacgaattgaccggtcaagctgttattgcattcgta
tcattgaaggaaggctacctacaaaatgatgccccagaaggtgatgctgaacatattact
cctagtaacttacgtagagagttgattctacaagtcagaggtgaaattggtccattcgct
tctccaaagtgtattatcttggtcagagacctaccaaaaaccagatctggtaagatcatg
agaagagttttaagaaagatcgcttccaatgaagcagaccaactaggtgatttgtctact
ttggctaatgctgatgttgttcctgccattatctctgcctgcgaaaaccaattcttcgca
gaaaagaaataa

DBGET integrated database retrieval system