KEGG   Candida glabrata: CAGL0C01903gHelp
Entry
CAGL0C01903g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cgr  Candida glabrata
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CAGL0C01903g
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CAGL0C01903g
   04113 Meiosis - yeast
    CAGL0C01903g
Protein phosphatases and associated proteins [BR:cgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CAGL0C01903g
Ubiquitin system [BR:cgr04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CAGL0C01903g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(199487..201796)
Genome map
AA seq 769 aa AA seqDB search
MVDSNGKSVPESEEDSNSLERIQQLQDVIRSCLEDLSYDSAEFYGEIMHAECSILDKSHF
YLPYYEYYYCLALYLNGKHLVAMKAAEPYIERNLATCFVFAKSALALSKHMDKAITSLLR
FLKSSNEIEMESSERSLLKFDIIEGNEKENRNERMPLPHGPTEATVHCLLGNLYYKISKM
DDSKGHYQKALSYNPYLWEAMAQLNKMGTSVDLPNHYRTLEKRNREWTEYYRTPLLVYNT
ESAINNPLSLGIPPDTITSHQQSNSKHRAKSSFQSTSRVKKARPFSSGSSLLFTPFKSTN
SPPVVRTTNTTTSAFISTTSPSSNSGPASQNSFSSAHKTPSYAVKGVSSGGPLFANSNNK
ITYKSNHSSVNSQAKSKTKGKLFSTPPSKLFSTNENHRDTLTKTPQTIKSSNEFQDLTFR
EEDEIDESQLAMKLLSNNGKEMKLSDLSYIFGLIAKCCSTYDAYKAIRLFHNCIPDHIVK
NMPWCLAQLGKLHYEIVNYEMASIYFMQLFELQPYRISDTEIFSTLLWHLQDYKRLASLV
DYLLTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDS
FDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCG
VALEKLEYQDKALEYYELACTLQPNSNLARFKRANLLYAMGRYNLALQSFEELSKLTPEE
PTVHFVLGQLYQIMGRKNEAIREFTVAMNLDPKGNQLILDALEKCHRQE
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggttgattcgaatgggaagtccgtgccggaatctgaagaggatagcaatagcctagaa
cgtatacaacagttgcaggatgtgatcagaagctgtttagaagacctaagctacgactct
gctgaattttacggtgaaatcatgcatgcagaatgctcaatactggataaatcacatttc
tacctaccgtactatgagtattattactgcttagcgttatacttgaatgggaaacacctt
gttgcaatgaaggctgctgagccatatatagaaagaaacctggcaacatgctttgtgttt
gccaaatctgcgctggcattgtcaaaacatatggacaaggcaattacatcgctactccga
ttcctgaagtccagtaatgaaatagaaatggaaagttctgagagaagtcttttaaaattt
gatattatcgaaggaaatgagaaagaaaaccggaatgagcggatgccattaccacatggt
cccactgaggcgactgtacactgtctgttgggtaacttgtattataaaatatctaaaatg
gatgatagtaagggacactatcaaaaggcgttgtcctataacccttatttatgggaggcc
atggcacaactgaataaaatgggtactagtgttgatcttcctaaccactacagaacttta
gaaaaaagaaatagagaatggacagaatattatagaacccccctcttagtatacaataca
gaatccgctattaataaccccctatcattaggaattccacctgatactattacttctcac
caacaatcaaattcaaagcatagagccaaatcaagttttcaaagtacttcacgagtaaag
aaagcacgaccattctcatcaggttcatcactgttgtttacccctttcaaaagtactaat
tcccctcctgtggtgagaactacaaacactaccacatctgcatttatttcaacgacttct
cctagttctaattctggtccagcctcccaaaattcttttagtagtgctcataagacacca
tcatatgctgttaaaggagtcagcagcgggggaccactctttgccaactcgaacaacaag
atcacgtataaaagtaaccactcttcagtcaattcgcaggcgaaatcaaagactaaaggc
aaattattttcaacacctccatcaaaacttttctcaactaatgaaaaccatagagataca
ttaactaaaacacctcaaacaataaaaagctctaacgaatttcaagatctaacttttaga
gaggaagatgaaattgatgaatctcaattggccatgaaattgttatcaaacaacggcaaa
gaaatgaagctttccgatctgtcatatatatttgggttgatcgcaaaatgctgttcgacg
tatgatgcatataaagcaatccgtttgttccacaattgtatccctgaccacatagtaaaa
aatatgccctggtgtctagcccaacttggtaaacttcattacgagattgttaattatgaa
atggcatcaatatactttatgcagctttttgaactacaaccttataggatatcggacact
gaaatattttctacgttactgtggcatttacaagattataaaaggttagctagccttgtt
gactatttgctaacttactatcctaataaacccgaaacttggtgttgtgtaggtaattat
ctttctttaaagaaagatcatgaagatgcaattgaagcgtttgagaaagctactaagatt
gacccaaagtttgcttatgcatacactttacaaggccatgaatgctcttccaacgactcg
tttgatgccgctaaaaagtgctttaggaaagcaattgcgtgtgatccaagacattacaat
gcatattacggtatgggtatatattcgatgaagctaggacattatgatgaagcattattg
tattttgaaaaagcccgacagatataccccataaatgctgttttaatttgctgttgtggt
gttgcactcgaaaaactcgaataccaagacaaggcccttgaatactatgaactggcatgc
actcttcaaccaaattctaaccttgcaaggtttaagagagccaatctgttgtatgctatg
ggccgctataacttagctctccagagctttgaagaattgagtaaattaacaccggaggaa
ccaacagtgcactttgtgctgggacagttgtatcagataatgggtcgcaaaaatgaagca
atacgagaattcaccgttgcgatgaatttagatccaaagggaaaccagttaattttggat
gcacttgaaaaatgccataggcaagaatga

DBGET integrated database retrieval system