KEGG   Candida glabrata: CAGL0C02255gHelp
Entry
CAGL0C02255g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K15339  
holliday junction resolvase YEN1 [EC:3.1.-.-]
Organism
cgr  Candida glabrata
Brite
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     CAGL0C02255g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(228009..229955)
Genome map
AA seq 648 aa AA seqDB search
MGVPAIWEFLKPYIKDRRKTLKGFVCQFRKENGRSPRIAIDGHNWLFECGFYHNDARAEP
FSFTKDSHDDDTLYAKPYMNMIHKLKELSLLDVSFVIVFDGPLKPKFKRQKETLRSITGT
ADVDTYLTSYVDSYRSFQTERPEGMMKKYMSQYTLKKVQELLNLLKVNYTFAYGEGESHC
AWLQISDHVDYVMSNDSDTLMFGATRVLRNLSKNLEDKSPSSRQGNNSTSSEAEYYITEV
NLQEINQKYGLQLSSASLLFFSLIIGGDYNSGLSGLGKTKALTLMNLQSPNFVKRLMEIF
HDIELDVALINSEYEKFQKEVYEYCQDNGRELFGRNYRILLSKENFRGWPEPYIVFHYIY
PIIDKNVPSNFLTPDFFTSVEGSSLFRSLDFVELMSYLERHGLPSFCNFTTWYHKTIHEY
FLLKQLKLFPDESVNSDLIKITEIKSDLDRSCMMDIKKYKVRYRTFIKTINEPVALESNE
LINENTGGLSPKKLSQRQVDVRHYPYYLWVPCDLVEEHNPLIIRYNQLQRQLEEKSPTKR
SKSESPRKRKSVYKQNNTLDGFLSKHASPVKPTQHTIEPPVLLQKDTEVKRRLFVGDDSS
NEENQTDPDTEDSLIIVEERDVSPRRTIEYLLSTSPLKRNYTSFSEKD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttccagctatttgggagtttctaaagccttacataaaggatcgaaggaagaca
ttgaaaggatttgtatgccagttcagaaaggaaaatggtagaagtccaagaatagcaatt
gatgggcataattggttatttgagtgtgggttttatcataacgatgctagagcggaaccg
ttcagcttcacaaaggatagccatgatgatgataccttatatgccaaaccctatatgaat
atgatacataaattgaaagaactatcattgctggatgtatcttttgtgatagtatttgat
ggaccattaaagcctaaatttaaaaggcagaaagagactctgagatctattactggaacg
gctgatgtagatacgtacttgacttcttatgtagacagttatcgctcgttccaaacagag
agacctgaaggtatgatgaagaagtacatgagccagtacacgctaaagaaagttcaggag
ctgcttaatttactaaaagttaattacacctttgcatatggagaaggtgaatcccattgc
gcgtggttgcaaatatccgaccatgtcgactatgttatgagcaatgattctgatacacta
atgtttggtgcaactagagtattaagaaacttatcaaaaaacttggaagacaagagccca
tcttctcgtcaagggaataacagcacatcatctgaggctgaatattacataacagaagtc
aatttacaagagataaaccagaaatacggtcttcaattgtcatctgcatcattattgttc
tttagtttgattattggtggtgattataattcaggattgagtggattaggtaaaacaaag
gcattaactttgatgaatttacaaagccccaactttgtaaagcgcctaatggagattttc
catgatattgaactagatgtggctttgataaacagcgaatatgaaaaatttcagaaagaa
gtgtacgagtactgccaagataatggtcgtgagctatttggtagaaactacaggatatta
ctaagtaaagaaaacttccgtggatggcctgaaccctatattgtattccactatatctat
cccataatcgataaaaatgttccatcaaacttcttgactccagatttttttaccagtgtg
gaaggtagctcattattcagatctctagattttgttgaattgatgtcatacttggagaga
catggactacccagcttctgtaatttcaccacttggtatcacaagacaatacatgagtac
ttcctactgaagcagctaaagctatttcctgatgagagtgtgaacagcgatttaattaag
ataactgaaatcaagtctgacttagatagatcttgcatgatggacatcaaaaaatacaaa
gtccgatatagaactttcatcaagactatcaacgagcctgttgcacttgagagcaatgag
ctaattaatgaaaatactgggggcctttcaccgaaaaagttaagtcagagacaagtagat
gtgcgccattatccatactacttgtgggtgccttgcgatcttgttgaagaacacaatcca
ctgataatacgctacaatcaactgcagagacaattagaagaaaagtcacctaccaagaga
tcgaaatctgaatcaccaagaaagcgtaaatcagtctacaagcagaacaacacactggat
ggtttcttatcaaaacatgcatctccagtcaaaccaacacaacacacaatagagccaccc
gtactgcttcagaaagacacagaggtgaaaaggaggctttttgtaggcgatgatagttcc
aatgaagagaatcaaacagaccccgacacagaggactcattaattatagtggaggaaagg
gacgtgagcccccgcagaactatcgagtacttgctatctacctccccattaaagagaaat
tacaccagtttcagtgaaaaggactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system