KEGG   Candida glabrata: CAGL0C04389gHelp
Entry
CAGL0C04389g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
cgr  Candida glabrata
Brite
Exosome [BR:cgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CAGL0C04389g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(424507..424896)
Genome map
AA seq 129 aa AA seqDB search
MSAEKKPASKAPAEKKPAAKKTAPSADGKKRTKARKETYSSYIYKVLKQTHPDTGISQKS
MSILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAV
TKYSSSTQA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgaaaagaagcctgcctccaaagccccagctgagaagaagccagctgccaag
aagaccgctccatctgctgacggtaagaagagaaccaaggccagaaaggagacttactcc
tcatacatctacaaggtcttgaagcaaactcacccagacaccggtatttctcaaaagtcc
atgtctattctaaactctttcgtcaacgatatcttcgaaagaatcgcttctgaagcttcc
aagttggctgcttacaacaagaagtctaccatctccgctagagaaatccaaaccgccgtc
agattgattttgccaggtgagttggctaagcacgccgtctctgaaggtactagagctgtc
accaagtactcttcttccactcaagcttag

DBGET integrated database retrieval system