KEGG   Candida glabrata: CAGL0C04389gHelp
Entry
CAGL0C04389g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
cgr  Candida glabrata
Brite
Chromosome and associated proteins [BR:cgr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CAGL0C04389g
Exosome [BR:cgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CAGL0C04389g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa CENP-W YscO-like
Motif
Other DBs
NCBI-GeneID: 2886743
NCBI-ProteinID: XP_445366
UniProt: Q6FWM8
Position
C:complement(424507..424896)
Genome map
AA seq 129 aa AA seqDB search
MSAEKKPASKAPAEKKPAAKKTAPSADGKKRTKARKETYSSYIYKVLKQTHPDTGISQKS
MSILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAV
TKYSSSTQA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgaaaagaagcctgcctccaaagccccagctgagaagaagccagctgccaag
aagaccgctccatctgctgacggtaagaagagaaccaaggccagaaaggagacttactcc
tcatacatctacaaggtcttgaagcaaactcacccagacaccggtatttctcaaaagtcc
atgtctattctaaactctttcgtcaacgatatcttcgaaagaatcgcttctgaagcttcc
aagttggctgcttacaacaagaagtctaccatctccgctagagaaatccaaaccgccgtc
agattgattttgccaggtgagttggctaagcacgccgtctctgaaggtactagagctgtc
accaagtactcttcttccactcaagcttag

DBGET integrated database retrieval system