KEGG   Candida glabrata: CAGL0C04609gHelp
Entry
CAGL0C04609g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cgr  Candida glabrata
Brite
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CAGL0C04609g
Peptidases [BR:cgr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CAGL0C04609g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:439306..440046
Genome map
AA seq 246 aa AA seqDB search
MAAVVPMESSPEVFNHVAHLLGLDNAHAFVDVYSLDDPDLLAMVPRPVSAIVLLFPLTEG
LREPIASGDAGKGRDNGSDNGSEAGNGSGVSWFRQSIKNACGLYAVLHALSNNKEILEPT
SVLGNFLESHSAMRFDDEQTNKFVLDAADKYRETFTMGSTSYPQDVDPSQIEVNLHFVTY
VVQNGHVYELDGRRAGPLDLGTADDSASDILAQPLLKSRIQELMSAAQNSQDSLNFSILG
LTEAWD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgtagttccaatggagtcgagtcccgaggtgttcaaccatgtggcgcacctg
ctggggctagacaatgcgcatgcgtttgtggatgtgtactcgctggacgaccctgacctg
ctggctatggtgcctcggcccgtgagtgccattgttcttctgttcccattgactgaagga
cttagggagccaattgcgtcaggggacgctggcaagggccgcgacaacggtagcgacaac
ggtagcgaggctggcaatggttcgggtgtctcctggtttagacaatcgatcaagaatgcc
tgcgggctgtacgccgtgctgcacgcattgagcaacaacaaggaaatactagagcccact
tcagtgttaggtaacttcctcgagtctcacagtgcgatgaggtttgatgacgaacagacg
aacaagtttgttctggatgccgcggacaaatatcgtgaaacgttcaccatggggtccacc
agttacccacaagatgtggatccatcacagatcgaggtcaatttgcattttgtgacttac
gtagtacagaacgggcacgtatacgagctggatggtcgcagggctggacccttggactta
gggacagcggacgacagcgcttcagatatacttgcgcaaccactcctaaaatctagaatc
caggaactaatgagcgcagcacagaactcacaggatagcttgaacttttccattctgggt
ttaacggaagcctgggactag

DBGET integrated database retrieval system