KEGG   Candida glabrata: CAGL0C05247gHelp
Entry
CAGL0C05247g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cgr  Candida glabrata
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CAGL0C05247g
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CAGL0C05247g
Transfer RNA biogenesis [BR:cgr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CAGL0C05247g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:501476..502549
Genome map
AA seq 357 aa AA seqDB search
MAFERELLVATQAVRKASLLTRRIQADVIAHRDSTTITKSDSSPVTVGDFAAQTIIINAI
KSNFPDDKIVGEESSDGLSDEFVSEILHQIKENDKIFDKQYNDSSIQFTSNEHPLSSLDD
VRKVIDCGNYEGGNKGRFWCLDPIDGTKGFLRGDQFAVCLGLIIDGIVQVGCIGCPNLSL
EKYGGSDLPGYKEFGYLFSAIKTQGAFYATCSTKVPDWKPIKVRQLKDTSEMISLEGVEK
SHSSHDEQSQIKAKLGINNSLHLDSQVKYCLLALGLADVYLRLPIKLSYREKIWDHAAGN
TIVLEAGGYHTDSMENLPLDFGKGRTLQTKGVIASSGPKDLHDLIVKTSADVINSRG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgaaagggaattactagtggctacgcaagcggtgcgcaaggcttctctgctg
accaggaggattcaggctgatgtaattgcccacagggatagcaccactattaccaagagt
gatagttctcctgtaacggtaggtgattttgctgcgcagactataattatcaatgcgatc
aagtctaatttcccagatgacaaaattgtaggtgaggagtcatctgatggtctttccgat
gagtttgtctctgagattctacatcaaattaaggagaacgacaagatatttgacaagcaa
tacaacgacagctcaattcagttcaccagcaacgagcacccactgagctccctagatgat
gtccgtaaagtcattgactgcggcaactacgaaggtggtaacaagggccgtttctggtgt
ttggatcctatcgatgggaccaaggggtttttaagaggagaccaatttgccgtgtgttta
ggactgatcatagacggaattgtccaagttggatgcattggctgcccaaatctgtccctg
gaaaagtatggtggttctgatctaccgggttataaggagtttggctacttgttcagtgct
attaagactcaaggtgcgttctatgctacctgttctaccaaagtaccagactggaaacct
atcaaggtaagacaattgaaggacaccagtgaaatgatctctttagaaggtgttgagaaa
tctcattcttcccatgacgaacaatctcaaataaaggccaagttgggcataaacaactcc
ctgcacttggattcccaagtcaaatactgcctcttggcattgggtctagctgacgtttac
ctacgtttaccaattaaactgtcttatagagagaaaatctgggaccacgctgccggaaat
actatagtattggaagctggtggataccacactgactctatggaaaatttgccactagat
ttcggtaagggtcgtactttgcagaccaagggtgtcattgcctctagtggacccaaagat
ttgcacgacttgatagtgaaaacatcagccgatgtcatcaactccagaggataa

DBGET integrated database retrieval system