KEGG   Candida glabrata: CAGL0D01430gHelp
Entry
CAGL0D01430g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K11482  histone deacetylase HOS1 [EC:3.5.1.98]
Organism
cgr  Candida glabrata
Brite
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CAGL0D01430g
Chromosome and associated proteins [BR:cgr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CAGL0D01430g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 2887160
NCBI-ProteinID: XP_445477
UniProt: Q6FWB7
Position
D:158990..160327
Genome map
AA seq 445 aa AA seqDB search
MVQLVISASQFQSQVVDLLPCNKRQKSQLIYSMLESYGLLECFDHIIDVPSCQRKDLEKF
HSKDYLNVILDEQLNWNPQIDGNEDQLMELRKAWNDITTSNEASKPDFKTYSELLHYYRD
HIEVSEHNKKRTALEAELSDVESGDEVTRRSTLAKFNLLDDCPIFPYLPLYCYVSTGATL
SLAQYILEGSERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRGGVDRISYVDFD
LHHGDGVEKAFKYSKQVQTISLHMYETGFFPCSGSLEDNSSGKSIVNIPLLHGLDDSTLQ
DIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQLSIKGLTSTITSLIEQFNCHIVL
LGGGGYNNLLMSRFYTYLTWSICHQYASEYSTPIDDLIQDHCYSDLYSPEQFKFWYYDQE
TSGGSLKNYNTTAYIEDLIKNIPLT
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggttcagctagtgatcagtgcatctcagttccaatcacaagtggtcgacctgctgcca
tgtaataagagacagaaatcacaattgatctactcaatgttggagagctatggactttta
gaatgctttgaccatataattgatgtgcctagttgtcaaaggaaggatctagagaagttt
cactcaaaagactacctcaacgtgatactcgatgagcaattgaattggaaccctcaaatc
gatggaaatgaagatcagttaatggagcttcggaaagcttggaacgatataaccaccagc
aatgaagcgtcaaaaccagatttcaaaacttattccgagttattgcattattatagggat
catattgaagtttctgaacataataagaagaggacagctctcgaggctgagctgtccgat
gttgaaagcggagatgaagttacaaggcgatccacgttggccaaattcaacttgttggat
gattgtcctatattcccatatttgccattgtactgctatgtgtcaacgggcgcaacatta
tcgctagcacaatacatactggaaggcagtgaaaggaccattgccattaactgggatggc
ggcaggcatcacagtatgaagacgaaagccagtggattttgctacatcaacgacatagct
ctgttaattatgacattgagacgtggcggtgtagatcgcatttcttatgttgactttgat
cttcaccatggtgatggagttgagaaagcgttcaagtacagtaagcaagtgcagacaatc
tcattgcacatgtatgagactgggttcttcccttgtagtggatctctcgaggataattct
agcggtaagagcatcgtcaacatcccactcttacacggtctagatgattcaactttacaa
gatatagcgaagaggattattgtaccgagtatatccaaacatcaacccaatgtaattgta
atccaatgtggtggcgatggcctgaaaggcgacaagtatagtgagtggcaactatccata
aagggcctgacatctacaattacctctttaatagagcagttcaattgccatattgtattg
cttggtggaggtgggtacaacaacttgctaatgagcaggttctacacatacttgacctgg
agcatatgccaccaatatgcctctgaatacagtacacccatcgatgatctgatacaggac
cactgttatagcgacctgtacagtccagagcagtttaaattctggtattacgaccaagaa
acttcaggaggctcgctcaaaaactacaatacaactgcatacattgaagacctaataaaa
aatataccactgacatga

DBGET integrated database retrieval system