KEGG   Candida glabrata: CAGL0D04114gHelp
Entry
CAGL0D04114g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cgr  Candida glabrata
Brite
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CAGL0D04114g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(406872..408935)
Genome map
AA seq 687 aa AA seqDB search
MDKTDLLVLIGLTLVVVLYLKRETIKSFISELLFAEEDSATTVSTSSRDIAEVVNEHGKN
YVVFYASQTGTAEDYAKKFAKELTAKFGLNVMCADVEYFDFETLNDLPDGCVVSFFVSTY
GEGDFPDGAVHLEDFLSNCGTTDLENVNFTIFGLGNCTYEFFNGASRKCNKYLLEAGAKQ
IGAAGEGDDGSGSTDEDYLAWKDAILEELKSKLKLDERQEKFVPSFKLETLETVTEKTSL
GEPSLQYLPANKLSFNDEGVQLGPFDLSQPYVAPVAKSYELFKSGDRNCIHSEIDVSGSN
IKYTTGDHLAIWPSNANEKVEQFLQLFNLKGDTIFNLKPLDSTIKVPFPCPTTIEATVRH
YLEITGPVSRQSFGSLIQFAPNEEIKQKLTALAKDKDLFAKEITAKCYNLADALLYVSNG
QPWSTVPWEFLIEAMAHIQPRYYSISSSSLSEKQTIHITSVVENSPNPVDPSLPPVVGVA
TNLLRNVQLAKNNEDTSSMPVHYDLNGPRNLFQGYKLPVHVRRSTFRLPTNPSTPVIMIG
PGTGVAPFRGFVRERVKFVEQQENVQLGKHLLFYGSRNTDDYLYREEWPEYAKKLGASFE
MIVGHSRIPGQPKVYVQDKIREHAQEVLKLIHEGAFLYICGDAKNMAQGVNAALVDILSE
DKKITKEEASEMIKMLKTTGRFQEDVW
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggataagactgatctgcttgttcttatcgggttgacgctagttgtggttctctacctg
aagagggagaccatcaagtcgtttatcagcgagctgctgtttgcggaggaggacagtgct
acaactgtttctacatcctctcgtgatattgctgaagttgtcaatgagcatggcaagaac
tacgttgtgttctacgcttcgcagactggtactgctgaagactatgccaagaagtttgcc
aaggagttgaccgctaagtttggtctgaatgttatgtgtgccgatgtcgagtacttcgac
ttcgaaactctgaatgatctgcctgatggctgtgtggtgtctttctttgtgtctacttat
ggtgaaggtgacttcccagacggtgctgtccacctcgaggacttcttgtccaactgtggc
accaccgacttggaaaacgtgaactttactatcttcggtttgggtaactgcacttacgag
ttcttcaacggtgcttccagaaagtgtaacaagtacttgctggaggccggtgccaaacag
atcggtgccgctggtgaaggtgacgacggttctggctccactgacgaggactacttggct
tggaaagacgcaatcctggaagaattgaagagcaaactgaaactggacgaacgtcaagag
aagtttgtgccttctttcaagttggagaccttggaaactgtcactgagaagacctccctc
ggtgagccctctttgcaatacttgcctgctaacaagctctctttcaacgacgaaggtgtc
caattgggcccattcgacctgtcccaaccatacgttgcccctgtcgccaagtcctacgag
ttgttcaagtccggcgaccgtaactgtatccactccgaaatcgatgtctctggctccaac
attaagtacaccaccggtgatcacttggctatctggccatccaacgccaacgaaaaggta
gaacaattcttgcaactgttcaacttgaaaggtgacaccatcttcaacttgaaacctctt
gactctaccattaaggtcccattcccttgcccaactaccatcgaagccactgtcagacac
tacttggaaatcaccggccctgtctctagacaatccttcggctctttgatccaatttgct
ccaaacgaagaaatcaaacagaagctgaccgctttggccaaggacaaggaccttttcgcc
aaagaaatcactgccaaatgttacaaccttgctgatgccttgctatacgtctccaacggc
caaccatggtccactgtcccatgggaattcttgattgaagctatggctcacatccaacct
cgttactactctatctcctcttcttccttgtccgaaaagcaaaccatccacattacctct
gttgttgaaaactctccaaaccctgttgacccatctctaccaccagttgtaggtgttgct
accaacttgctgagaaacgtgcaacttgccaagaacaacgaagatacttcctctatgcct
gtccactacgatctaaacggtcctcgtaacctattccaaggctacaagcttcctgtccac
gtccgtcgttccactttcagattgccaaccaacccatctaccccagtcatcatgattggt
ccaggtactggtgtcgccccattccgtggtttcgtcagggaaagagttaagttcgttgag
caacaagaaaacgtccaacttggtaagcatttattgttctatggttcccgtaacactgac
gactacctatacagagaagaatggccagaatatgctaagaagcttggtgcctcctttgag
atgattgtgggccattccagaatcccaggtcaaccaaaggtctacgtccaggacaagatc
agagaacacgcacaggaagttttgaagctgattcatgaaggtgctttcttatacatttgt
ggtgatgctaagaacatggctcaaggtgtcaacgctgcactagtcgatattctgtctgaa
gacaagaagatcacaaaggaagaagcttctgaaatgataaagatgttgaagactaccggc
agattccaagaagatgtgtggtaa

DBGET integrated database retrieval system