KEGG   Candida glabrata: CAGL0D05170gHelp
Entry
CAGL0D05170g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K06658  
phosphate system positive regulatory protein PHO4
Organism
cgr  Candida glabrata
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CAGL0D05170g
Transcription factors [BR:cgr03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Fungal regulators
    CAGL0D05170g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:493897..495498
Genome map
AA seq 533 aa AA seqDB search
MGEQVEDMDKLYETPIDMQTTIFDQVDNYLHMVNSGLQHDEKEDEHREHEDAIDGGASLN
MHLYNINDTLNGVSTDNGHFDMVDLHFGPTLTTDDDPTKMAELQHTTIHHGHLDVNGNRS
DSLFSPFDSPLVHDTPSLEARNSIQLTNEGSTSALTTPFLSGKNHYDDHGNSINSQSFNY
HNRNSSLSKVSGKFSPISSPALTSTNQEQQHWNTSSRRASNSSSRSKRVLPSGNSSVSST
SNKVIKNSPYMNASSRRLQKTISNGNSKRDEWDEFMFSLPESSLANDLTTGNDENMDISL
PAGHSPTKEYNSYPKVILPSHAAENESMETDNYERASLLEDSQPDETQNNNPQNNNPHSN
GSSISPVGKNDSVMLASGSPVLKPQNSSSNILQTPYSSKRVFKSPADISSTEQTADEASN
DASNDAKSKDKKQRKPSSSGPNKLKRTNTGGSIGRVRSDSASQNSDYVQRKKEVHKYAEQ
ERRNRLNNALSDLNSLLPQDWKDAVTVPSKAITAELACKYIRTLLEELEQYKK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaacaggtagaggatatggacaagctgtatgagacgccgatagacatgcagact
acaatctttgaccaagtagataactatctgcatatggtgaacagcggattacagcacgat
gagaaagaagatgaacatagggaacatgaagatgcgattgatggtggggccagtctgaac
atgcacctttacaatattaatgatacattaaatggtgtttctactgataacggtcatttc
gacatggttgatttacatttcgggcccacattgactacagatgacgacccaaccaaaatg
gccgaactacagcataccacgatacatcatggccatctagacgtcaatggaaaccgcagt
gatagtttattctcgccattcgattctccattagtacatgacactccatcattggaggct
aggaatagtatacaacttacaaatgagggttccacatcagctcttacaacaccatttctg
agcggcaagaaccactatgacgaccacgggaactctataaattcccagagctttaactac
cataacagaaactcaagtctctccaaagttagtggtaaattctccccaatatcgtcacca
gcactgacttctactaatcaggaacagcaacactggaacacatcctctagaagggcttca
aacagttcctctagatcaaaaagagtgctaccgagtggtaattcatctgtttcttctact
tcaaacaaggttataaagaatagtccgtacatgaacgccagttctaggagattacaaaag
accataagtaatgggaactcaaagagggatgagtgggacgaattcatgttctctttaccg
gagagtagtttagctaatgacttaacaactggaaatgatgaaaacatggatattagcttg
ccagcgggacactcacccactaaagagtacaatagctaccctaaggtaatattaccatct
catgcagctgaaaacgagagtatggaaacggataactatgagagggccagcttgctagag
gactcacaaccagacgagacacagaacaataacccacagaacaataatccacatagcaat
ggctctagtatcagtcctgttggcaaaaacgactcggtgatgctagccagtggctcacct
gtgttgaaaccccaaaattcaagttctaatattttgcagacaccttactcatctaaaaga
gttttcaagtcgccagcggatatttcaagcactgaacaaactgcagacgaggcttccaac
gatgcaagtaatgatgctaagtcgaaggacaagaaacaaaggaaaccttcatccagtgga
cccaataagctaaagagaactaatactggtggcagcatcgggagagtacgatcagacagt
gccagccaaaacagcgactatgttcaaagaaagaaagaggtgcataagtacgcagaacaa
gaaagaagaaacaggctgaacaacgcgcttagcgatttgaactctttacttccacaagac
tggaaagacgctgtcacagtcccatctaaggctatcacagctgaactcgcttgcaaatac
ataaggacactgctcgaagagcttgagcagtacaagaaatga

DBGET integrated database retrieval system